BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c09 (785 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35287| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.6 SB_14922| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.9 >SB_35287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 28.7 bits (61), Expect = 5.6 Identities = 22/74 (29%), Positives = 36/74 (48%), Gaps = 1/74 (1%) Frame = +1 Query: 394 IQSGQSVLFSSTAEFLLQNMKKFPMEVSL-WSKEENLAFIGATFIPWDPMFLSYLEKIYN 570 I + L SST L+ ++K+F V L ++ +++ +G T + W+P S K Sbjct: 134 ITKAATTLISST---LVPSVKRFNSPVLLTFAHKQSSKGMGVTCVSWEPESYSNSWKDSG 190 Query: 571 CQEPPPVTLKEEYN 612 CQ P + EYN Sbjct: 191 CQVVP--DMSNEYN 202 >SB_14922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 505 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = +1 Query: 544 LSYLEKIYNCQEPPPVTLKEEYNVFEEGTAKLMAKLGIQIKLSYLSDRVT 693 L+Y +Y + PV+L ++ F++ A L AK+ + +KL++ S T Sbjct: 17 LNYNMDLYMIKNDEPVSLLKDSRAFKDFLAPLSAKIDV-VKLNWFSSPKT 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,159,115 Number of Sequences: 59808 Number of extensions: 402468 Number of successful extensions: 970 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 969 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -