BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c08 (377 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C2.04c |ubp11||ubiquitin C-terminal hydrolase Ubp11|Schizo... 27 1.3 SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosacch... 25 5.2 SPBC32H8.06 |mug93||TPR repeat protein, meiotically spliced|Schi... 25 5.2 >SPBC19C2.04c |ubp11||ubiquitin C-terminal hydrolase Ubp11|Schizosaccharomyces pombe|chr 2|||Manual Length = 350 Score = 26.6 bits (56), Expect = 1.3 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 94 AFSFLQNVRQTMELRKHDCRSPTLLRKFPSESLFVG 201 A FLQ++ +T+EL+K + + FP +S F+G Sbjct: 131 AQEFLQHLVETLELQKPHTYKWSKVLSFPVDSPFIG 166 >SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 24.6 bits (51), Expect = 5.2 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 146 TAEAPLCCENSQVKVCS 196 T+E P CC N + VC+ Sbjct: 281 TSEKPSCCSNGKSTVCA 297 >SPBC32H8.06 |mug93||TPR repeat protein, meiotically spliced|Schizosaccharomyces pombe|chr 2|||Manual Length = 383 Score = 24.6 bits (51), Expect = 5.2 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -2 Query: 361 IEVMXEISNSVINANTVRFIYNFYRLSFIRKNN 263 I+V E N++ N NT+ +Y L+ +RK + Sbjct: 24 IDVFDEFLNAIGNENTITPVYADSSLTHLRKKS 56 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,159,836 Number of Sequences: 5004 Number of extensions: 19558 Number of successful extensions: 46 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 122233080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -