BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11c06 (423 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1385 - 33157557-33157655,33157752-33158201,33158864-331590... 31 0.29 05_03_0653 + 16617121-16617359,16618892-16618955,16619455-166194... 28 2.7 03_02_0085 - 5539188-5539388,5539576-5539714,5540108-5540279,554... 27 6.2 >04_04_1385 - 33157557-33157655,33157752-33158201,33158864-33159004, 33159058-33159329,33160371-33160821 Length = 470 Score = 31.5 bits (68), Expect = 0.29 Identities = 13/41 (31%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +1 Query: 208 CYCWNPCAKPA--CCSNEYWCYTRHRPTSTLQETTTLRRRD 324 CY W C CC + Y C P +Q+ T L +D Sbjct: 401 CYAWGCCPLEGATCCDDHYSCCPHEYPICNVQQGTCLMAKD 441 >05_03_0653 + 16617121-16617359,16618892-16618955,16619455-16619485, 16619577-16619848,16620528-16620633,16620715-16620872, 16621527-16621714,16621786-16621855,16622814-16622984, 16624363-16624838,16625625-16625871,16626158-16626490, 16627329-16627412,16627751-16627843,16627966-16628025, 16628582-16628680,16628830-16628970,16629207-16629287, 16629895-16629966,16631160-16631231,16632083-16632176, 16632257-16632339,16632455-16632532,16632914-16632970, 16633055-16633132,16633236-16633357,16633463-16633623, 16634419-16634495,16634570-16634683,16634857-16634958, 16635368-16635436,16635437-16635577,16635936-16636109, 16636934-16637063,16637137-16637276,16637369-16637446, 16637813-16637911,16638408-16638803 Length = 1749 Score = 28.3 bits (60), Expect = 2.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +1 Query: 289 TLQETTTLRRRDCLYQWRRNCL 354 +L T LR CL++W NCL Sbjct: 630 SLSSATALRAPPCLFRWLENCL 651 >03_02_0085 - 5539188-5539388,5539576-5539714,5540108-5540279, 5541119-5541165,5541450-5541527,5542113-5542177, 5543108-5543155,5543393-5543473,5543586-5543783 Length = 342 Score = 27.1 bits (57), Expect = 6.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 133 CYKIS*RWG*SCRYKLSRSFRTHCC 207 C +++ RWG S R K+ + + CC Sbjct: 165 CQRVNARWGSSERRKVQKHLKLRCC 189 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,378,513 Number of Sequences: 37544 Number of extensions: 136542 Number of successful extensions: 297 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 297 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 778540620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -