BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b24 (540 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 25 2.1 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 5.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 6.5 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 6.5 AY062203-1|AAL58564.1| 149|Anopheles gambiae cytochrome P450 CY... 23 8.7 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 24.6 bits (51), Expect = 2.1 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -3 Query: 385 GPCMSHQ*CY-PNNKKNLYAVLHHSSAVLCRSLHIC 281 G C +Q C P K N+++VL H V S+ IC Sbjct: 110 GHCTRYQSCKGPELKDNVWSVLQHLCIVEGISVGIC 145 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 17 NGSQRMQRFGRRSNNSHLCVLV 82 N ++R FGR +N C++V Sbjct: 549 NAARRAMSFGRTNNRDRRCLMV 570 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.0 bits (47), Expect = 6.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 196 AYQHNNVNQWTSAVVESCLGQ 258 AY+HNN+NQ + + S G+ Sbjct: 598 AYKHNNLNQSMACTIVSQGGE 618 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.0 bits (47), Expect = 6.5 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 407 TALSQSLGLAYNMDLLYSFTGL 472 + S ++ YN+ L Y FTGL Sbjct: 227 STFSGAIAWGYNLPLAYFFTGL 248 >AY062203-1|AAL58564.1| 149|Anopheles gambiae cytochrome P450 CYP4C25 protein. Length = 149 Score = 22.6 bits (46), Expect = 8.7 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 248 HDSTTAEVHWLTLL 207 HD+T+A + W+ LL Sbjct: 10 HDTTSAAISWILLL 23 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 542,391 Number of Sequences: 2352 Number of extensions: 11302 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -