BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b22 (737 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2F12.03c |||EST1 family protein|Schizosaccharomyces pombe|ch... 32 0.098 SPCC1020.05 |||phosphoprotein phosphatase |Schizosaccharomyces p... 27 2.1 SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyce... 27 2.8 SPCC74.02c |||mRNA cleavage and polyadenylation specificity fact... 26 4.9 SPBC29B5.01 |atf1|mts1, sss1, gad7|transcription factor Atf1|Sch... 25 8.5 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 25 8.5 SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosacc... 25 8.5 >SPBC2F12.03c |||EST1 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 891 Score = 31.9 bits (69), Expect = 0.098 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 1 KKIVSSFSVKC*IIILKSMMKCVSENQKCYDKKKQNQ 111 KK++ +F C +++ K SE++K YD KKQ+Q Sbjct: 31 KKLLGNFKENCTSVVVDGHKKPRSESRKKYDAKKQHQ 67 >SPCC1020.05 |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 3|||Manual Length = 509 Score = 27.5 bits (58), Expect = 2.1 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 370 GDSAGHFGRVRRALLVQPEPFEEAIR 293 G GH G VRRA + + +P E A+R Sbjct: 461 GGYGGHGGYVRRARVFELDPVERAVR 486 >SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1347 Score = 27.1 bits (57), Expect = 2.8 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 374 RINARLTSHDKQIRQSTLDKLWNKQSGGIQMLLSILESSRDTPTS 508 R + R T + Q ++ K W ++S +Q L IL++ RDT T+ Sbjct: 1254 RSSFRKTIEEIQ-QEEEFQKWWEEESLRVQKELGILKTERDTSTN 1297 >SPCC74.02c |||mRNA cleavage and polyadenylation specificity factor complex associated protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 710 Score = 26.2 bits (55), Expect = 4.9 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 300 ASSNGSGCTSSALRTRPKWPALSPHASMRVSLHMTNR 410 ++ N S +SSA+ P PA++P AS + S T + Sbjct: 343 STKNDSTVSSSAVVMAPAGPAMAPSASNKPSASSTTK 379 >SPBC29B5.01 |atf1|mts1, sss1, gad7|transcription factor Atf1|Schizosaccharomyces pombe|chr 2|||Manual Length = 566 Score = 25.4 bits (53), Expect = 8.5 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 338 ESAAGAT*AVRRGNPSLHRPP 276 E + G+T +V +GNPSL+R P Sbjct: 94 EHSFGSTASVGQGNPSLNRNP 114 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.4 bits (53), Expect = 8.5 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +1 Query: 478 FGIFKR-HANFDLRNGYFEGDAMLE 549 FG K H N D R GY +G A++E Sbjct: 33 FGPVKNLHLNLDRRTGYVKGYALIE 57 >SPAC17H9.10c |ddb1||damaged DNA binding protein Ddb1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1072 Score = 25.4 bits (53), Expect = 8.5 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 240 FVWADESAAAYE*KKLKTNNYVSMYLE 160 ++ ADES Y+ K L T+ VSM LE Sbjct: 279 YIVADESGMLYKFKALFTDETVSMELE 305 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,043,052 Number of Sequences: 5004 Number of extensions: 62762 Number of successful extensions: 177 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 177 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -