BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b21 (740 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 25 0.56 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 25 0.56 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 25 0.56 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 25 0.56 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 25 0.99 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 24 1.7 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 5.3 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 9.2 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 9.2 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 9.2 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 21 9.2 AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. 21 9.2 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 25.4 bits (53), Expect = 0.56 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 202 NTY*KYNYSFNNFSLGCQK 146 N Y KYNY+ NN++ C+K Sbjct: 94 NNY-KYNYNNNNYNNNCKK 111 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 25.4 bits (53), Expect = 0.56 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 202 NTY*KYNYSFNNFSLGCQK 146 N Y KYNY+ NN++ C+K Sbjct: 94 NNY-KYNYNNNNYNNNCKK 111 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 25.4 bits (53), Expect = 0.56 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 202 NTY*KYNYSFNNFSLGCQK 146 N Y KYNY+ NN++ C+K Sbjct: 94 NNY-KYNYNNNNYNNNCKK 111 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 25.4 bits (53), Expect = 0.56 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 202 NTY*KYNYSFNNFSLGCQK 146 N Y KYNY+ NN++ C+K Sbjct: 94 NNY-KYNYNNNNYNNNCKK 111 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 24.6 bits (51), Expect = 0.99 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +2 Query: 131 PECAFFLTPQRKIIETIIVFLICVYLLVCIYFSL 232 P CA LTP ++ + I F + +++ IY L Sbjct: 182 PTCALDLTPTYAVVSSSISFYVPCIVMLGIYCRL 215 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 23.8 bits (49), Expect = 1.7 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 300 LAKV*IISIKNYSNFR*RLIQY*KYPLIRITPKVTEAAND 419 +AK+ I+ N+SNF R+ Y Y I K+TE N+ Sbjct: 19 IAKIIGINAANFSNFEDRVTMY-VYEEIINGKKLTEIINE 57 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/36 (25%), Positives = 16/36 (44%) Frame = +2 Query: 545 APPSKIVTALFRIHLYLLNGPLLAFLFPETASRKIF 652 A P K+ +RI +L +L P T + ++ Sbjct: 2 ASPQKLANKFYRISPQILKNDKRIYLSPRTPIKNVY 37 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 9.2 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +2 Query: 632 TASRKIFVEAALYWIQHGMMCIIPYYLLRLGGVYNI 739 T++ + AL I M PY ++ G++N+ Sbjct: 270 TSAECKLAKVALMTISLWFMAWTPYLVINFSGIFNL 305 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.4 bits (43), Expect = 9.2 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 202 NTY*KYNYSFNNFS 161 N Y YNY+ NN++ Sbjct: 99 NNYNNYNYNNNNYN 112 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 9.2 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -2 Query: 100 TTIRP--FEHFYNIFNSSILFEQKRLYF*LKSSY 5 T ++P F H Y I+ S +KRL L SSY Sbjct: 33 TKLQPTYFHHTYIIYESLCGRHEKRLLNELLSSY 66 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 9.2 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -2 Query: 100 TTIRP--FEHFYNIFNSSILFEQKRLYF*LKSSY 5 T ++P F H Y I+ S +KRL L SSY Sbjct: 33 TKLQPTYFHHTYIIYESLCGRHEKRLLNELLSSY 66 >AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. Length = 76 Score = 21.4 bits (43), Expect = 9.2 Identities = 9/36 (25%), Positives = 17/36 (47%) Frame = +2 Query: 632 TASRKIFVEAALYWIQHGMMCIIPYYLLRLGGVYNI 739 T++ + AL I M PY ++ G++N+ Sbjct: 20 TSAECKLAKVALMTISLWFMAWTPYLVINFSGIFNL 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 208,535 Number of Sequences: 438 Number of extensions: 4859 Number of successful extensions: 14 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -