BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b18 (753 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 22 5.4 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 7.1 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 22.2 bits (45), Expect = 5.4 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = +2 Query: 407 PGIVKHRNSFRSLHRPDLK--RVPYLRRMKPDE 499 P + + S LHRPD K VP L + PD+ Sbjct: 122 PNLFIYALSVAILHRPDTKDLPVPPLTEVFPDK 154 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 485 CDVDKVLVLDQVGEE 441 CDVD DQ+G+E Sbjct: 132 CDVDVSTFFDQLGQE 146 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,749 Number of Sequences: 438 Number of extensions: 4816 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -