BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b15 (603 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 4.6 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 22 4.6 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.0 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 8.0 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 8.0 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 4.6 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +2 Query: 287 AMSRHSERK*ERKHHI*FFSNKGDS 361 A H ER+ HH +S GDS Sbjct: 364 AFDFHREREPVADHHANLYSRPGDS 388 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.8 bits (44), Expect = 4.6 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -3 Query: 199 RWCAMVLFTVIFWQGCRCVSNIF 131 RW VI GC C+ +IF Sbjct: 39 RWYICYTIGVIITIGCLCIWSIF 61 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 8.0 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = -3 Query: 151 RCVSNIFPICFLIFN---SSQLLKYDYK*YNTKSEVHKTVK 38 RC + F L F+ S L DYK T S++H VK Sbjct: 743 RCKFSEFMTKLLEFDVKLQSDRLMIDYKTQKTGSKIHLFVK 783 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 35 LFYCLVNF*LCIVLF 79 LFYC++ LCI F Sbjct: 227 LFYCVLIILLCIYYF 241 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -3 Query: 442 SFCVSRWVLIFCNNSFFTES 383 SFC L++C+ +FF S Sbjct: 42 SFCTFVAALVYCSVTFFALS 61 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,822 Number of Sequences: 336 Number of extensions: 2791 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -