BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b14 (800 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0782 + 23114532-23114596,23116259-23116316,23116445-231165... 103 2e-22 06_01_0050 - 444267-444914 31 1.1 09_01_0025 - 441528-444284 30 1.9 04_04_0523 - 25900802-25902548,25902640-25903037 29 4.3 12_01_0486 + 3854889-3855014,3855897-3856089,3856206-3856310,385... 29 5.7 12_01_0237 + 1782593-1782778,1784942-1784996,1785086-1787028,178... 29 5.7 11_01_0518 + 4057428-4057538,4059609-4059801,4059921-4060025,406... 29 5.7 05_04_0384 - 20809397-20811547 29 5.7 02_05_0019 - 25025218-25026964,25027084-25027478 29 5.7 02_05_0016 - 25004075-25005821,25006394-25006527 29 5.7 02_02_0592 - 11934238-11934249,11934755-11934835,11935166-119353... 29 5.7 02_04_0195 + 20830849-20830950,20831498-20831690,20831800-208319... 28 7.5 01_06_1713 - 39359558-39359590,39360000-39360074,39360437-393606... 28 7.5 01_01_1018 - 8046819-8046876,8046995-8047212,8048099-8048177,804... 28 7.5 04_03_0130 - 11622139-11623325,11626144-11627116 28 9.9 >12_02_0782 + 23114532-23114596,23116259-23116316,23116445-23116516, 23117468-23117587,23117668-23117769,23118254-23118274 Length = 145 Score = 103 bits (247), Expect = 2e-22 Identities = 48/123 (39%), Positives = 82/123 (66%), Gaps = 3/123 (2%) Frame = +2 Query: 278 EKHRKYKVMEYTLATKRRRLRQQIPDLARTIEVIEKLKEQK---EEVETQFLLSDQVFVK 448 ++ ++YK++E L ++R L+ +IPD+ + ++++ L+ +K E + F LS+ ++ + Sbjct: 21 QRLQQYKIVEMKLLAQQRDLQAKIPDIEKCLDIVATLQAKKALGEALTADFELSEGIYSR 80 Query: 449 ANVPPTKSVCLWLGANVMLEYSLEDAEKLLTTNMETAQENLNQVEHDLDFLRDQCTTTEV 628 A + T SVCLWLGANVMLEYS ++A LL N+E A+ +L + DL FLRDQ T T++ Sbjct: 81 AKIEDTDSVCLWLGANVMLEYSCDEANALLKKNLENAKASLEVLVADLQFLRDQQTITQI 140 Query: 629 NMA 637 ++ Sbjct: 141 RLS 143 >06_01_0050 - 444267-444914 Length = 215 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 260 VLKSLDEKHRKYKVMEYTLATK-RRRLRQQIPDLARTIEVIEKLKEQKEE 406 VLK +KH K ++ A K RRRL + + + A I +EK ++QK E Sbjct: 12 VLKKGKKKHAKDELDRQKQAEKKRRRLEKALANSAAIISELEKKRQQKRE 61 >09_01_0025 - 441528-444284 Length = 918 Score = 30.3 bits (65), Expect = 1.9 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 602 RDQCTTTEVNMARVYNWDVKKRQAASGRITTC 697 +DQC+++ N +Y WDV R + G+ +C Sbjct: 459 KDQCSSSSQNAHHLYAWDVPSRISLIGQHCSC 490 >04_04_0523 - 25900802-25902548,25902640-25903037 Length = 714 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = -3 Query: 246 SALIGDFINSSTLSTNSASGIPEYDLGFEGSTPSPSIFIYCEVYIQFLEN 97 S L+ DF N+ S S P D GF+G+ ++ YC +QFL N Sbjct: 426 SELVNDFYNNGLPSNLSGGRNPSLDYGFKGA--EIAMASYCS-ELQFLAN 472 >12_01_0486 + 3854889-3855014,3855897-3856089,3856206-3856310, 3856541-3856629,3856720-3856872,3857047-3857181, 3857293-3857459,3858193-3858287,3858495-3858868, 3859101-3859374,3859464-3859531 Length = 592 Score = 28.7 bits (61), Expect = 5.7 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -2 Query: 208 IYKFSFWYSRIRLRVRGFYSVSFHF 134 +Y +S +Y ++ ++ GF+ SF+F Sbjct: 532 VYLYSIYYYHVKTKMSGFFQTSFYF 556 >12_01_0237 + 1782593-1782778,1784942-1784996,1785086-1787028, 1787103-1787261,1787432-1787603,1787705-1788003, 1788278-1788583 Length = 1039 Score = 28.7 bits (61), Expect = 5.7 Identities = 23/102 (22%), Positives = 44/102 (43%), Gaps = 1/102 (0%) Frame = +2 Query: 245 EGVDVVLKS-LDEKHRKYKVMEYTLATKRRRLRQQIPDLARTIEVIEKLKEQKEEVETQF 421 E DV K+ +E R+++ T+ RRR + +PDL R K++ +E++ Sbjct: 10 ENFDVPAKNPSEEAQRRWRQAVGTIVKNRRRRFRWVPDLERRSLDKAKVRSTQEKIRVAL 69 Query: 422 LLSDQVFVKANVPPTKSVCLWLGANVMLEYSLEDAEKLLTTN 547 + + ++ K L G + Y++ E L T+ Sbjct: 70 YVQQAALIFSDGAKKKEYKL-TGDIIKAGYAINPDELALITS 110 >11_01_0518 + 4057428-4057538,4059609-4059801,4059921-4060025, 4060259-4060347,4060424-4060576,4060754-4060888, 4061241-4061407,4062129-4062223,4062367-4062740, 4062903-4063176,4063806-4063822 Length = 570 Score = 28.7 bits (61), Expect = 5.7 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -2 Query: 208 IYKFSFWYSRIRLRVRGFYSVSFHF 134 +Y +S +Y ++ ++ GF+ SF+F Sbjct: 527 VYLYSIYYYHVKTKMSGFFQTSFYF 551 >05_04_0384 - 20809397-20811547 Length = 716 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = -3 Query: 246 SALIGDFINSSTLSTNSASGIPEYDLGFEGSTPSPSIFIYCEVYIQFLEN 97 S L+ DF N+ S S P D GF+G+ ++ YC +QFL N Sbjct: 428 SELVNDFYNNGLPSNLSGGRNPSLDYGFKGA--EIAMASYCS-ELQFLGN 474 >02_05_0019 - 25025218-25026964,25027084-25027478 Length = 713 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = -3 Query: 246 SALIGDFINSSTLSTNSASGIPEYDLGFEGSTPSPSIFIYCEVYIQFLEN 97 S L+ DF N+ S S P D GF+G+ ++ YC +QFL N Sbjct: 425 SELVNDFYNNGLPSNLSGGRNPSLDYGFKGA--EIAMASYCS-ELQFLGN 471 >02_05_0016 - 25004075-25005821,25006394-25006527 Length = 626 Score = 28.7 bits (61), Expect = 5.7 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = -3 Query: 246 SALIGDFINSSTLSTNSASGIPEYDLGFEGSTPSPSIFIYCEVYIQFLEN 97 S L+ DF N+ S S P D GF+G+ ++ YC +QFL N Sbjct: 338 SELVNDFYNNGLPSNLSGGRNPSLDYGFKGA--EIAMASYCS-ELQFLGN 384 >02_02_0592 - 11934238-11934249,11934755-11934835,11935166-11935324, 11936362-11936442,11936523-11936591,11937147-11937260, 11937805-11937858,11938788-11938915,11940527-11940782 Length = 317 Score = 28.7 bits (61), Expect = 5.7 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +2 Query: 503 LEYSLEDAEKLLTTNMETAQENLNQV---EHDLDFLRDQCTTTEVNMARVY 646 LE LE+ K L + +EN N + EHD++ L ++ +T+ + ++ Y Sbjct: 85 LESLLEENTKTLKSKANNLEENSNLIGTMEHDIEILMNKYESTKKSQSKSY 135 >02_04_0195 + 20830849-20830950,20831498-20831690,20831800-20831904, 20832147-20832235,20832316-20832468,20832628-20832762, 20832849-20833015,20833519-20833613,20833707-20834080, 20834177-20834599 Length = 611 Score = 28.3 bits (60), Expect = 7.5 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -2 Query: 208 IYKFSFWYSRIRLRVRGFYSVSFHF 134 +Y +S +Y ++ ++ GF+ SF+F Sbjct: 524 VYLYSVYYYHVKTKMSGFFQTSFYF 548 >01_06_1713 - 39359558-39359590,39360000-39360074,39360437-39360662, 39360792-39360880,39360960-39361053,39361134-39361318, 39361415-39361582,39361682-39361822,39362327-39362545, 39362628-39362744,39363154-39363248,39363662-39363743, 39363864-39363926,39364157-39364216,39364312-39364476, 39364574-39364759,39364890-39365180,39365262-39365405, 39365492-39366172,39367045-39367362 Length = 1143 Score = 28.3 bits (60), Expect = 7.5 Identities = 35/151 (23%), Positives = 67/151 (44%) Frame = +2 Query: 173 SYSGIPEAEFVDNVDEFMKSPINAEGVDVVLKSLDEKHRKYKVMEYTLATKRRRLRQQIP 352 S++ I E ++N +E +KS +G + +LK++++ R ++E A K Sbjct: 307 SHALIKETSVMNNQEETIKS--EEKGAEKILKNIEDIKRS--IIERDTAVKNAE--DGAA 360 Query: 353 DLARTIEVIEKLKEQKEEVETQFLLSDQVFVKANVPPTKSVCLWLGANVMLEYSLEDAEK 532 D+ + + + K ++ E+ E Q +L+ K+N K + L E K Sbjct: 361 DMKKRADDLTKELDESEK-EYQGVLAG----KSNANEKKCLEDQLRDAKAAVGEAESGLK 415 Query: 533 LLTTNMETAQENLNQVEHDLDFLRDQCTTTE 625 LTT + +++ L + L RD+ T E Sbjct: 416 QLTTKISHSEKELKDKKAQLVSKRDEATAAE 446 >01_01_1018 - 8046819-8046876,8046995-8047212,8048099-8048177, 8048455-8048540,8048698-8048983,8049063-8049205, 8049308-8049508,8049626-8049754,8050463-8050738, 8050823-8051098,8051364-8052364,8052452-8052634, 8052865-8052937,8053205-8053313,8053622-8053785 Length = 1093 Score = 28.3 bits (60), Expect = 7.5 Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 3/82 (3%) Frame = +2 Query: 329 RRLRQQIPDLARTIEVIEKLKEQKEEVETQFLLSDQVFVKANVPPTKS-VCLWLGANVML 505 +RL+ +P L E+ E KEQ+ + ++ V + PTKS C LG N+ Sbjct: 371 KRLKVDVPHLVHVNEM-EASKEQQPAANETYASAETVQSEVTNSPTKSPCCTSLGDNIAC 429 Query: 506 EYSLE--DAEKLLTTNMETAQE 565 ++ D +L + ++T +E Sbjct: 430 TDNVHGMDMVRLSGSAVQTEEE 451 >04_03_0130 - 11622139-11623325,11626144-11627116 Length = 719 Score = 27.9 bits (59), Expect = 9.9 Identities = 20/70 (28%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Frame = -3 Query: 504 NITLAPSHKHTDFVGGTLAFTNT*SLRRNCVSTSSFCSFNFSIT-SIVRAKSGI-CCRNR 331 N+ A + ++GG + SL CV+T + N ++T V A SGI CCR Sbjct: 139 NVFTAIGCRTLAYIGGDNVDADVGSLTTGCVATCRLQAGNLTVTDDDVGACSGIGCCRTS 198 Query: 330 LLLVANVYSI 301 + + Y + Sbjct: 199 IPVGLQYYYV 208 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,886,823 Number of Sequences: 37544 Number of extensions: 301454 Number of successful extensions: 850 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 828 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 846 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2174172540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -