BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b11 (514 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0066 + 17621532-17621619,17621658-17621820,17621864-176222... 32 0.31 03_05_0642 - 26346260-26346367,26347902-26348162,26348542-263498... 28 5.1 12_02_0439 + 19096711-19096713,19096819-19096893,19097037-190971... 27 6.7 11_06_0388 + 23048576-23051546,23051830-23052371,23052444-230525... 27 6.7 11_06_0454 + 23786984-23786986,23787062-23787136,23787242-237873... 27 8.8 >05_04_0066 + 17621532-17621619,17621658-17621820,17621864-17622233, 17622548-17623009 Length = 360 Score = 31.9 bits (69), Expect = 0.31 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +2 Query: 20 RFYFTLNI*YHI*K*IVMPLDYSNPYIIKFLSENFEKETKSRVAW 154 R+ F LN Y + ++P DYS P IKF E ++KE R +W Sbjct: 223 RYLFLLNNSYVVQYQFLVPSDYSPPSEIKFHYEQYQKE-YMRASW 266 >03_05_0642 - 26346260-26346367,26347902-26348162,26348542-26349849, 26349960-26350178,26350241-26350300,26352159-26352215, 26352945-26353029,26353486-26353843,26353931-26355170 Length = 1231 Score = 27.9 bits (59), Expect = 5.1 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Frame = -2 Query: 345 LYVNFIGSC*GATFRRLTLFSKCCLERVLSNISIGFRITSS---KWYPL*FAENLSLLEI 175 + V +G C A R T+ + C E S GF + + +W PL + +S+L++ Sbjct: 339 MIVELVGCCDRALASRSTIHRQFCFEPQHLRSSFGFSSSETLQYQWMPLIKSPVMSILDV 398 Query: 174 S 172 S Sbjct: 399 S 399 >12_02_0439 + 19096711-19096713,19096819-19096893,19097037-19097111, 19097225-19097297,19097536-19097580,19098217-19098328, 19098794-19098866,19099178-19099222,19100216-19100271, 19100370-19100545,19101289-19101476 Length = 306 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/40 (35%), Positives = 23/40 (57%) Frame = +2 Query: 188 LKFSANYKGYHLEDVIRKPIEMLLRTLSRQHLENNVNRRK 307 ++F + YHL+DVI I LL + +++E V RR+ Sbjct: 178 IEFEYSKSKYHLKDVIIGKIYFLLVRIKIKNMELEVRRRE 217 >11_06_0388 + 23048576-23051546,23051830-23052371,23052444-23052517, 23053006-23053090,23053281-23053367,23053585-23053657, 23053882-23053925,23054041-23054169,23054301-23054402, 23054529-23054585 Length = 1387 Score = 27.5 bits (58), Expect = 6.7 Identities = 19/80 (23%), Positives = 41/80 (51%), Gaps = 1/80 (1%) Frame = +2 Query: 224 EDVIRKPIEMLLRTLSRQHLENNVNRRKVAPQQDPIKF-TYKVHRPKNDTQFCRFITETI 400 E +I +PIE T S + + ++ + +PI+ + K+ DTQ + I++ I Sbjct: 352 EKIISEPIE----TQSEKIISEPIDAQSEKIISEPIEAQSEKIISEPIDTQTEKIISDPI 407 Query: 401 NSLKNDEIMKPVEAEVQKML 460 + I +P++A+ +K++ Sbjct: 408 EAQSEKIISEPIDAQTEKII 427 >11_06_0454 + 23786984-23786986,23787062-23787136,23787242-23787316, 23787534-23787606,23787965-23788009,23788398-23788509, 23788640-23788706,23789010-23789054,23790138-23790193, 23790280-23790455,23790584-23790710,23791384-23791426 Length = 298 Score = 27.1 bits (57), Expect = 8.8 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 188 LKFSANYKGYHLEDVIRKPIEMLLRTLSRQHLENNVNRRK 307 ++F + YHL+DVI I LL + +++E + RR+ Sbjct: 176 IEFEYSKSKYHLKDVIVGKIYFLLVRIKIKNMELEIRRRE 215 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,987,376 Number of Sequences: 37544 Number of extensions: 189651 Number of successful extensions: 390 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 390 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1106928780 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -