BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b09 (729 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC663.15c |||conserved fungal protein|Schizosaccharomyces pomb... 27 3.6 SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |S... 26 4.8 SPAC31G5.15 |||phosphatidylserine decarboxylase |Schizosaccharom... 25 8.4 >SPCC663.15c |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 657 Score = 26.6 bits (56), Expect = 3.6 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = +1 Query: 496 KVADEAVKELHAEED*DVVDPRPTKGVHKEMRVKKEALYH 615 +V D A + H+E + DP KGVH MR AL H Sbjct: 385 EVPDTASETEHSEIEDFHFDPYSEKGVHIAMRYFDAALTH 424 >SPAC4A8.11c |fas2|lsd1|fatty acid synthase alpha subunit Lsd1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1842 Score = 26.2 bits (55), Expect = 4.8 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -2 Query: 653 STAKIATEKTALRWYNASFLTLISLCTPLVG 561 S +K+ E RWY+ S+ +++C ++G Sbjct: 798 SESKLGLETLFNRWYSESWANYLTICGAVIG 828 >SPAC31G5.15 |||phosphatidylserine decarboxylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 980 Score = 25.4 bits (53), Expect = 8.4 Identities = 10/43 (23%), Positives = 20/43 (46%) Frame = -2 Query: 713 ARTHSAEPSSIHWARTSPTASTAKIATEKTALRWYNASFLTLI 585 A H A +S W R T+ ++ + RW++ +F ++ Sbjct: 610 ATVHLATCASHDWKRVDRLMMTSYVSLNQAQRRWFSKAFAKVV 652 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,350,156 Number of Sequences: 5004 Number of extensions: 35958 Number of successful extensions: 117 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 343230174 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -