BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b06 (576 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosacch... 27 2.6 SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces... 25 6.0 SPAC6G10.09 |||glucosidase I Gls1 |Schizosaccharomyces pombe|chr... 25 7.9 SPBC1683.12 |||nicotinic acid plasma membrane transporter |Schiz... 25 7.9 SPAC57A7.04c |pabp||mRNA export shuttling protein |Schizosacchar... 25 7.9 SPBC28E12.03 |rga4||GTPase activating protein Rga4|Schizosacchar... 25 7.9 SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pom... 25 7.9 >SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2196 Score = 26.6 bits (56), Expect = 2.6 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -1 Query: 504 CCTALGISIEAYLKMHWADRSEMLEFQDSQRLARDTVL 391 CCT L +S + + HW + F+ R R+T L Sbjct: 328 CCTLLCLSPKQFFLKHWISSLDAAFFRVKDRRLRNTGL 365 >SPBC16C6.02c |vps1302|vps13b|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3131 Score = 25.4 bits (53), Expect = 6.0 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -3 Query: 442 RDVGVSGLAATRTGYSFGSRRGPIISFRLQPPSFPGGSC 326 R G + +TGY+ + G + S +Q S P G C Sbjct: 1744 RPEGYPYVILNQTGYNLSIQYGNLNSSEMQSLSLPSGKC 1782 >SPAC6G10.09 |||glucosidase I Gls1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 808 Score = 25.0 bits (52), Expect = 7.9 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +3 Query: 342 KEGGWSRNEIMGPLLDPKLYPVRVAASPETPTSRYDQPNAF 464 KEG W +E++ LLD K+ +V + E S D P A+ Sbjct: 221 KEGAWRTSELILYLLDTKM---KVISDKEGYESLKDLPPAY 258 >SPBC1683.12 |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 482 Score = 25.0 bits (52), Expect = 7.9 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 34 SYISTLWILFCNP 72 S IS LWILFC P Sbjct: 214 SAISALWILFCLP 226 >SPAC57A7.04c |pabp||mRNA export shuttling protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 653 Score = 25.0 bits (52), Expect = 7.9 Identities = 18/66 (27%), Positives = 33/66 (50%) Frame = +3 Query: 357 SRNEIMGPLLDPKLYPVRVAASPETPTSRYDQPNAFLDKLQSKYPMLYSILQNEASPELK 536 SR +++G LL PK++ S + + PN+ L +L L + NEA L+ Sbjct: 584 SRKQVLGELLYPKVFVREEKLSGKITGMLLEMPNSELLELLEDDSALNERV-NEAIGVLQ 642 Query: 537 QRIDRD 554 + +D++ Sbjct: 643 EFVDQE 648 >SPBC28E12.03 |rga4||GTPase activating protein Rga4|Schizosaccharomyces pombe|chr 2|||Manual Length = 933 Score = 25.0 bits (52), Expect = 7.9 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +2 Query: 371 NGSSPRSKTVSRASRCES*NSNISLRSAQCIFR*ASIEIPNAVQHP 508 NG S RS S C+S +S S+ R +S+ N+VQ P Sbjct: 247 NGPSFRSANASPFDSCDSFHSGSSIPIEPVSSRQSSVVNNNSVQQP 292 >SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1562 Score = 25.0 bits (52), Expect = 7.9 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Frame = +3 Query: 279 RPPDCRCPQYSGGEMPQLPPGKEGGWSRNEIMGPLLDPK--LYPVRVAASPETPTSR 443 R D R P+ + + PQLPP S + P +DP+ LY + + P ++ Sbjct: 357 RSTDEREPERTSEDPPQLPPSPSSPSSPALSVKPNIDPQPPLYNSTLTTTRSIPANK 413 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,640,038 Number of Sequences: 5004 Number of extensions: 58072 Number of successful extensions: 191 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 185 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 191 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -