BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b05 (689 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 24 5.2 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 6.9 AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding pr... 23 9.1 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 23.8 bits (49), Expect = 5.2 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 78 LDQEDEFEKYLEILKSYLNELQDQKLLEICSAWV 179 LD+ + ++ +EI+ + L+ +LLEI WV Sbjct: 233 LDEREAEKELIEIIVMHQKALKCVELLEIIFRWV 266 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 6.9 Identities = 12/44 (27%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 375 PYEPNSLANEDDLDNLQNHKLNLKTSKTFET-TTRPSRSINDFN 503 P P+SLA++ +N H+L +++ +T R N+F+ Sbjct: 3145 PLSPDSLADDSSGENHNKHRLQRSRAQSRKTFRNRRGMRSNNFS 3188 >AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding protein AgamOBP45 protein. Length = 356 Score = 23.0 bits (47), Expect = 9.1 Identities = 12/28 (42%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = +3 Query: 447 TSKTFETTTRPSRSINDFNRKILHC-NC 527 T+ T TT S +FN K L+C NC Sbjct: 301 TTTTTPTTATACPSTTEFNYKELNCQNC 328 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 627,413 Number of Sequences: 2352 Number of extensions: 11334 Number of successful extensions: 17 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -