BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b03 (666 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) 28 5.9 SB_31542| Best HMM Match : FeS (HMM E-Value=1.6) 28 7.9 SB_21570| Best HMM Match : AT_hook (HMM E-Value=2) 28 7.9 >SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) Length = 492 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 422 RGRGRPKKTWMESVNDDMREREKAHTKAPRVMRRR 526 R RGRP+ TW ++ D ++ K + R+ + R Sbjct: 439 RKRGRPRNTWRRDLDADAKQMGKTWGQLERLAQNR 473 >SB_31542| Best HMM Match : FeS (HMM E-Value=1.6) Length = 553 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +2 Query: 434 RPKKTWMESVNDDMREREKAHTKAPRVMRRRTSEVQDNQFYTQAP 568 R K E D + + +KAH ++P+V ++ + ++ D+ + P Sbjct: 89 RQLKAGSEKAFDPVNKDKKAHKQSPKVSKKSSKQLHDSYYDPSDP 133 >SB_21570| Best HMM Match : AT_hook (HMM E-Value=2) Length = 148 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 422 RGRGRPKKTWMESVNDDMREREKAHTKAPRVMR 520 R RGRP+ TW ++ D + K + R++R Sbjct: 112 RKRGRPRNTWRRDLDADAKHMGKTWGQLERLVR 144 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,983,705 Number of Sequences: 59808 Number of extensions: 357698 Number of successful extensions: 757 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 680 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 757 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -