BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11b03 (666 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17705-1|CAA76825.1| 124|Anopheles gambiae opsin protein. 24 5.0 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 24 5.0 >Y17705-1|CAA76825.1| 124|Anopheles gambiae opsin protein. Length = 124 Score = 23.8 bits (49), Expect = 5.0 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 517 HHSRGLRVSFLSLSHIVIHRLHP 449 HH R LRV + H ++ LHP Sbjct: 10 HHLRHLRVLAAAADHHLLVHLHP 32 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.8 bits (49), Expect = 5.0 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +3 Query: 342 TFK--LLMPRCCSGNHLKVHRRRDRSPIVGEEVDRRRHG 452 TFK L P C + L V R +R+ ++ E R+HG Sbjct: 337 TFKGYLKCPLCNEQHPLHVCERFERASVINREEIVRKHG 375 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 643,128 Number of Sequences: 2352 Number of extensions: 11594 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -