BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11a23 (696 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O58527 Cluster: Putative uncharacterized protein PH0797... 33 5.1 UniRef50_Q8IFX6 Cluster: Putative uncharacterized protein; n=5; ... 33 8.8 >UniRef50_O58527 Cluster: Putative uncharacterized protein PH0797; n=1; Pyrococcus horikoshii|Rep: Putative uncharacterized protein PH0797 - Pyrococcus horikoshii Length = 554 Score = 33.5 bits (73), Expect = 5.1 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +2 Query: 497 ISTPWSSETWDSAVFNSANSEKTLTPKSST--SYGATTPFFSVSSKNTLTLLESA 655 ++T WS W+S N N K + P ST S+ T ++SK LL ++ Sbjct: 135 VNTSWSRLVWNSQSVNEINGWKIVIPNLSTNSSFPTTVDIIVINSKENANLLNNS 189 >UniRef50_Q8IFX6 Cluster: Putative uncharacterized protein; n=5; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 2232 Score = 32.7 bits (71), Expect = 8.8 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = +2 Query: 506 PWSSETWDS----AVFNSANSEKTLTPKSSTSYGATTPFFSVSSKNTLT 640 P SS T+ S A +S S T+ P SS++YG++TP S SS T++ Sbjct: 363 PGSSSTFASSTPIASSSSPGSTVTVAPGSSSTYGSSTPSASSSSSGTMS 411 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,500,355 Number of Sequences: 1657284 Number of extensions: 10435785 Number of successful extensions: 21722 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21661 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54958682807 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -