BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11a17 (378 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0387 - 3426058-3426168,3426279-3426473,3426612-3426724,342... 27 6.5 >08_01_0387 - 3426058-3426168,3426279-3426473,3426612-3426724, 3427121-3427157,3427270-3427341,3427849-3427962, 3428129-3428200,3428343-3428381,3429340-3429414, 3429561-3429674,3429749-3429813,3429927-3430047, 3430942-3431063,3431547-3431634 Length = 445 Score = 26.6 bits (56), Expect = 6.5 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +1 Query: 190 EPEVLRTDDFHSQLELMATITSNHQRFXTADSP 288 +PEV + F ++ LM I SNH+RF D+P Sbjct: 268 KPEVC-SYPFTTRGILMGHIVSNHERFQVTDTP 299 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,432,876 Number of Sequences: 37544 Number of extensions: 141741 Number of successful extensions: 210 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 210 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 612769692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -