BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11a12 (465 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4QFG0 Cluster: Serine/threonine protein phosphatase; n... 35 1.0 UniRef50_P41567 Cluster: Eukaryotic translation initiation facto... 31 9.4 >UniRef50_Q4QFG0 Cluster: Serine/threonine protein phosphatase; n=5; Trypanosomatidae|Rep: Serine/threonine protein phosphatase - Leishmania major Length = 374 Score = 34.7 bits (76), Expect = 1.0 Identities = 18/58 (31%), Positives = 34/58 (58%) Frame = +1 Query: 214 QEYTSKSLQESRTSVGLL*MRILLSSTAIVMTEPSI*I*IRKYYKCV*SHS*FFNMID 387 + YTSK L+E R GL+ ++IL+ + AI+ +EP + Y C H ++++++ Sbjct: 44 ERYTSKVLEEQRIPEGLI-VQILIKARAIIASEPMLVELDSPVYACGDLHGQYYDLVN 100 >UniRef50_P41567 Cluster: Eukaryotic translation initiation factor 1; n=53; Eukaryota|Rep: Eukaryotic translation initiation factor 1 - Homo sapiens (Human) Length = 113 Score = 31.5 bits (68), Expect = 9.4 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +3 Query: 141 KKMVKTNSNKCTCNVHQQCQPESGPGVHFQESPRVKNICRFTID 272 KK+VK K CN PE G + Q R KNIC+F ++ Sbjct: 57 KKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQR-KNICQFLVE 99 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 355,056,839 Number of Sequences: 1657284 Number of extensions: 5413873 Number of successful extensions: 10521 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10521 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 25191138900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -