BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11a12 (465 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyc... 26 2.5 SPAC25B8.06c |||serine-tRNA ligase|Schizosaccharomyces pombe|chr... 24 9.9 SPAC977.14c |||aldo/keto reductase, unknown biological role|Schi... 24 9.9 SPBC56F2.07c |||AAA family ATPase, unknown biological role|Schiz... 24 9.9 >SPAC25G10.07c |cut7||kinesin-like protein Cut7|Schizosaccharomyces pombe|chr 1|||Manual Length = 1085 Score = 26.2 bits (55), Expect = 2.5 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +1 Query: 178 VMCINSVSRSQAQEYTSKSLQESRTSVGLL*MRILLSSTAI 300 V+ +N S + +Y SKS QE + V L ++++ SST + Sbjct: 490 VLDLNVKSSREQLQYVSKSNQEHKKEVEALQLQLVNSSTEL 530 >SPAC25B8.06c |||serine-tRNA ligase|Schizosaccharomyces pombe|chr 1|||Manual Length = 454 Score = 24.2 bits (50), Expect = 9.9 Identities = 15/55 (27%), Positives = 22/55 (40%) Frame = +1 Query: 97 RKEEMYGEDQNFXXXXXXXXPIPINAHVMCINSVSRSQAQEYTSKSLQESRTSVG 261 R EM+ E NF IP M + S +Q+Y ++ +R S G Sbjct: 324 RSSEMFNEIVNFQKEFVETLKIPARILNMPTAELGSSASQKYDIEAWMPARQSYG 378 >SPAC977.14c |||aldo/keto reductase, unknown biological role|Schizosaccharomyces pombe|chr 1|||Manual Length = 351 Score = 24.2 bits (50), Expect = 9.9 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = +3 Query: 207 SGPGVHFQESPRVKNICRFTIDAYFT*LNGNCHD*TKYLDI 329 S GVHF +SP + N C + F + + Y+D+ Sbjct: 112 SSRGVHFLDSPELANQCGLSRKHIFDAVEDSVKRLGTYIDV 152 >SPBC56F2.07c |||AAA family ATPase, unknown biological role|Schizosaccharomyces pombe|chr 2|||Manual Length = 809 Score = 24.2 bits (50), Expect = 9.9 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 40 IRDPGRTSKRICVGLPKKDRK 102 +R PGR K I +G+P K + Sbjct: 432 LRRPGRLEKEIEIGIPDKSAR 452 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,539,902 Number of Sequences: 5004 Number of extensions: 24900 Number of successful extensions: 49 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 176367270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -