BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11a12 (465 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_1263 + 27423411-27423464,27423985-27424104,27424200-274242... 27 9.8 >12_02_1263 + 27423411-27423464,27423985-27424104,27424200-27424298, 27424405-27424542,27424647-27424706,27424865-27425044, 27425132-27425338,27425415-27425534,27425609-27425728, 27425819-27425941,27426074-27426178,27426379-27426523, 27426967-27427131,27427228-27427466,27427553-27427585, 27427894-27427975,27428100-27428260,27428422-27428607, 27428700-27428882,27428969-27429147,27429386-27429482 Length = 931 Score = 26.6 bits (56), Expect = 9.8 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = -2 Query: 314 GSVMTIAVELSKIRIYSKPTDVLDSWRLLEVYS 216 G++MTI SK R+ KP+ + DSW+L E+++ Sbjct: 664 GTIMTI----SKDRV--KPSPLPDSWKLAEIFT 690 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,063,890 Number of Sequences: 37544 Number of extensions: 135163 Number of successful extensions: 232 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 229 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 232 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 931320312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -