BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11a12 (465 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholi... 22 3.7 EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholi... 22 3.7 EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholi... 22 3.7 DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 21 4.9 >EF127805-1|ABL67942.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 6 protein. Length = 461 Score = 21.8 bits (44), Expect = 3.7 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +2 Query: 221 TLPRVSKSQEHL*VYYRCVFYLAQRQ--LS*LNQVFRYR 331 TLP+VS + L Y+ C+ ++ L+ L +F +R Sbjct: 246 TLPQVSDAIPLLGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127804-1|ABL67941.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 5 protein. Length = 461 Score = 21.8 bits (44), Expect = 3.7 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +2 Query: 221 TLPRVSKSQEHL*VYYRCVFYLAQRQ--LS*LNQVFRYR 331 TLP+VS + L Y+ C+ ++ L+ L +F +R Sbjct: 246 TLPQVSDAIPLLGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >EF127803-1|ABL67940.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 4 protein. Length = 461 Score = 21.8 bits (44), Expect = 3.7 Identities = 12/39 (30%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +2 Query: 221 TLPRVSKSQEHL*VYYRCVFYLAQRQ--LS*LNQVFRYR 331 TLP+VS + L Y+ C+ ++ L+ L +F +R Sbjct: 246 TLPQVSDAIPLLGSYFNCIMFMVASSVVLTVLVLIFHHR 284 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 21.4 bits (43), Expect = 4.9 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 221 TLPRVSKSQEHL*VYYRCVFYL 286 TLP+VS + L Y+ C+ ++ Sbjct: 314 TLPQVSDAIPLLGSYFNCIMFM 335 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,930 Number of Sequences: 438 Number of extensions: 1695 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12436029 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -