BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11a11 (701 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 27 0.17 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 27 0.23 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 27 0.23 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 25 0.70 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 25 0.92 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 25 0.92 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 25 0.92 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 25 0.92 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 24 1.2 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 24 1.2 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 24 1.6 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 24 1.6 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 24 1.6 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 2.1 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 2.1 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 2.1 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 2.1 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 23 2.1 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 23 2.1 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 23 2.1 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 2.8 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 23 3.7 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 23 3.7 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 23 3.7 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 23 3.7 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 23 3.7 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 23 3.7 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 3.7 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 3.7 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 23 3.7 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 3.7 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 3.7 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 3.7 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 3.7 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 3.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 3.7 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 4.9 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 4.9 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 4.9 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 4.9 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 4.9 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 4.9 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 4.9 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 4.9 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 4.9 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 22 4.9 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 22 4.9 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 22 4.9 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 22 4.9 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 22 4.9 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 22 4.9 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 22 4.9 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 22 4.9 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 4.9 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 4.9 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 4.9 L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 22 6.5 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 8.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 8.6 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 27.1 bits (57), Expect = 0.17 Identities = 12/50 (24%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQKHGCIVSIHNL-------IYCERYPRNDLGPYLQL 75 N + Y N Y ++ + I++I + IYC +P +GP++ + Sbjct: 339 NNNNYNNNYNNNCKKLYYNIINIEQIPVPVPVPIYCGNFPPRPMGPWISI 388 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 26.6 bits (56), Expect = 0.23 Identities = 16/73 (21%), Positives = 30/73 (41%) Frame = +2 Query: 152 HVFDEAGENTHYHSDSDSVASRKSKTRYINPAIYVEKIEATHSVTSLQTGSCVDDVTPHP 331 H+ D A + + +D + A ++K Y + HS++ + +G+ H Sbjct: 407 HLIDVASDR-FFITDGEKAARMQAKVNRQPVWFYYYTYKGAHSISEIMSGTSNKYGVCHA 465 Query: 332 HSDYRSNSTPFLS 370 Y TPFL+ Sbjct: 466 DDAYMVVDTPFLA 478 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 26.6 bits (56), Expect = 0.23 Identities = 16/73 (21%), Positives = 30/73 (41%) Frame = +2 Query: 152 HVFDEAGENTHYHSDSDSVASRKSKTRYINPAIYVEKIEATHSVTSLQTGSCVDDVTPHP 331 H+ D A + + +D + A ++K Y + HS++ + +G+ H Sbjct: 407 HLIDVASDR-FFITDGEKAARMQAKVNRQPVWFYYYTYKGAHSISEIMSGTSNKYGVCHA 465 Query: 332 HSDYRSNSTPFLS 370 Y TPFL+ Sbjct: 466 DDAYMVVDTPFLA 478 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 25.0 bits (52), Expect = 0.70 Identities = 11/50 (22%), Positives = 24/50 (48%), Gaps = 7/50 (14%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQKHGCIVSIHNL-------IYCERYPRNDLGPYLQL 75 N + Y N + ++ + I++I + IYC +P +GP++ + Sbjct: 337 NYNNYNNNNYNNYKKLYYNIINIEQIPVPVPVPIYCGNFPPRPMGPWISI 386 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 24.6 bits (51), Expect = 0.92 Identities = 9/43 (20%), Positives = 19/43 (44%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQKHGCIVSIHNLIYCERYPRNDLGPYLQL 75 N + Y + + + V + IYC +P +GP++ + Sbjct: 98 NNNNYNKKLYYNINYIEQIPVPVPVPIYCGNFPPRPMGPWISI 140 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 24.6 bits (51), Expect = 0.92 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -1 Query: 134 HNLIYCERYPRN 99 HN IYCE+Y +N Sbjct: 158 HNDIYCEKYEKN 169 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 24.6 bits (51), Expect = 0.92 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQKHGCIVSIHNL-----IYCERYPRNDLGPYLQL 75 N + Y N Y ++L K+ I++I + IYC +P +GP++ + Sbjct: 334 NNNNYNN-YNKKLYYKN-YIINIEQIPVPVPIYCGNFPPRPMGPWISI 379 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 24.6 bits (51), Expect = 0.92 Identities = 9/43 (20%), Positives = 19/43 (44%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQKHGCIVSIHNLIYCERYPRNDLGPYLQL 75 N + Y + + + V + IYC +P +GP++ + Sbjct: 336 NNNNYNKKLYYNINYIEQIPVPVPVPIYCGNFPPRPMGPWISI 378 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQ-KHGCIVSIHNL-----IYCERYPRNDLGPYLQL 75 N + Y N Y ++ ++ I++I + IYC +P +GP++ + Sbjct: 93 NYNNYNNNYNTNYKKLQYYNIINIEQIPVPVPIYCGNFPPRPMGPWISI 141 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQ-KHGCIVSIHNL-----IYCERYPRNDLGPYLQL 75 N + Y N Y ++ ++ I++I + IYC +P +GP++ + Sbjct: 93 NYNNYNNNYNTNYKKLQYYNIINIEQIPVPVPIYCGNFPPRPMGPWISI 141 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQ-KHGCIVSIHNL-----IYCERYPRNDLGPYLQL 75 N + Y N Y ++ ++ I++I + IYC +P +GP++ + Sbjct: 93 NYNNYNNNYNTNYKKLQYYNIINIEQIPVPVPIYCGNFPPRPMGPWISI 141 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQ-KHGCIVSIHNL-----IYCERYPRNDLGPYLQL 75 N + Y N Y ++ ++ I++I + IYC +P +GP++ + Sbjct: 93 NYNNYNNNYNTNYKKLQYYNIINIEQIPVPVPIYCGNFPPRPMGPWISI 141 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQ-KHGCIVSIHNL-----IYCERYPRNDLGPYLQL 75 N + Y N Y ++ ++ I++I + IYC +P +GP++ + Sbjct: 93 NYNNYNNNYNTNYKKLQYYNIINIEQIPVPVPIYCGNFPPRPMGPWISI 141 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQ-KHGCIVSIHNL-----IYCERYPRNDLGPYLQL 75 N + Y N Y ++ ++ I++I + IYC +P +GP++ + Sbjct: 97 NYNNYNNNYNTNYKKLQYYNIINIEQIPVPVPIYCGNFPPRPMGPWISI 145 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 24.2 bits (50), Expect = 1.2 Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQ-KHGCIVSIHNL-----IYCERYPRNDLGPYLQL 75 N + Y N Y ++ ++ I++I + IYC +P +GP++ + Sbjct: 93 NYNNYNNNYNTNYKKLQYYNIINIEQIPVPVPIYCGNFPPRPMGPWISI 141 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 23.8 bits (49), Expect = 1.6 Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 6/49 (12%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQ-KHGCIVSIHNL-----IYCERYPRNDLGPYLQL 75 N + Y N Y ++ ++ I++I + IYC +P +GP++ + Sbjct: 93 NYNNYNNNYNTNYKKLQYYNIINIEQIPVPVPIYCGNFPPRPMGPWISV 141 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/43 (20%), Positives = 19/43 (44%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQKHGCIVSIHNLIYCERYPRNDLGPYLQL 75 N + Y + + + V + IYC +P +GP++ + Sbjct: 98 NDNNYNKKLYYNINYIEQIPVPVPVPIYCGNFPPRPMGPWISI 140 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 23.8 bits (49), Expect = 1.6 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQKHGCIVSIHNL-----IYCERYPRNDLGPYLQL 75 N + Y N Y ++L K+ I++I + IYC +P +GP++ + Sbjct: 93 NYNNYNN-YNKKLYYKN-YIINIEQIPVPVPIYCGNFPPRPMGPWISI 138 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P LGP++ + Sbjct: 129 IYCGNFPPRPLGPWISI 145 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P LGP++ + Sbjct: 129 IYCGNFPPRPLGPWISI 145 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P LGP++ + Sbjct: 129 IYCGNFPPRPLGPWISI 145 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P LGP++ + Sbjct: 129 IYCGNFPPRPLGPWISI 145 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/43 (18%), Positives = 19/43 (44%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQKHGCIVSIHNLIYCERYPRNDLGPYLQL 75 N + Y + + + V + +YC +P +GP++ + Sbjct: 100 NYNNYNKKLYYNINYIEQIPVPVPVPVYCGNFPPRPMGPWISI 142 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/43 (18%), Positives = 19/43 (44%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQKHGCIVSIHNLIYCERYPRNDLGPYLQL 75 N + Y + + + V + +YC +P +GP++ + Sbjct: 104 NNNNYNKKLYYNIINIEQIPVPVPVPVYCGNFPPRPMGPWISM 146 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/43 (18%), Positives = 19/43 (44%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQKHGCIVSIHNLIYCERYPRNDLGPYLQL 75 N + Y + + + V + +YC +P +GP++ + Sbjct: 104 NNNNYNKKLYYNIINIEQIPVPVPVPVYCGNFPPRPMGPWISM 146 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/49 (20%), Positives = 26/49 (53%), Gaps = 6/49 (12%) Frame = -1 Query: 203 NRSRYGNEYFRQLRQK-HGCIVSIHNL-----IYCERYPRNDLGPYLQL 75 N++ + N ++ +K + I++I + +YC +P +GP++ + Sbjct: 320 NKTIHNNNNYKNYNKKLYYNIINIEQIPVPVPVYCGNFPPRPMGPWISI 368 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 123 IYCGNFPPRPMGPWISM 139 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 123 IYCGNFPPRPMGPWISM 139 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 123 IYCGNFPPRPMGPWISM 139 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 127 IYCGNFPPRPMGPWISI 143 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 125 IYCGNFPPRPMGPWISM 141 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 135 IYCGNFPPRPMGPWISM 151 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 344 IYCGNFPPRPMGPWISM 360 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 341 IYCGNFPPRPMGPWISI 357 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 350 IYCGNFPPRPMGPWISI 366 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 352 IYCGNFPPRPMGPWISI 368 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 340 IYCGNFPPRPMGPWISI 356 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 351 IYCGNFPPRPMGPWISI 367 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 351 IYCGNFPPRPMGPWISI 367 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.6 bits (46), Expect = 3.7 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 340 IYCGNFPPRPMGPWISI 356 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = +2 Query: 617 QEKREKARLEKQKQHTIPATTPEQRE 694 Q +++ + ++Q QH I A P+Q++ Sbjct: 419 QAQQQHQQQQQQTQHVINAQQPQQQQ 444 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 +YC +P +GP++ + Sbjct: 125 VYCGNFPPRPMGPWISM 141 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 127 IYCGNFPSRPMGPWVPM 143 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 127 IYCGNFPSRPMGPWVPM 143 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 127 IYCGNFPSRPMGPWVPM 143 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 127 IYCGNFPSRPMGPWVPM 143 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 127 IYCGNFPSRPMGPWVPM 143 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 127 IYCGNFPSRPMGPWVPM 143 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 127 IYCGNFPSRPMGPWVPM 143 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/17 (35%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 IYC +P +GP++ + Sbjct: 130 IYCGNFPSRPMGPWVPM 146 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 +YC +P +GP++ + Sbjct: 125 VYCGNFPPRPMGPWISM 141 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 +YC +P +GP++ + Sbjct: 125 VYCGNFPPRPMGPWISM 141 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 +YC +P +GP++ + Sbjct: 125 VYCGNFPPRPMGPWISM 141 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 +YC +P +GP++ + Sbjct: 125 VYCGNFPPRPMGPWISM 141 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 +YC +P +GP++ + Sbjct: 125 VYCGNFPPRPMGPWISM 141 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 +YC +P +GP++ + Sbjct: 125 VYCGNFPPRPMGPWISM 141 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 +YC +P +GP++ + Sbjct: 125 VYCGNFPPRPMGPWISM 141 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 +YC +P +GP++ + Sbjct: 125 VYCGNFPPRPMGPWISM 141 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 +YC +P +GP++ + Sbjct: 358 VYCGNFPPRPMGPWISM 374 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 4.9 Identities = 5/17 (29%), Positives = 11/17 (64%) Frame = -1 Query: 125 IYCERYPRNDLGPYLQL 75 +YC +P +GP++ + Sbjct: 358 VYCGNFPPRPMGPWISM 374 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/21 (33%), Positives = 14/21 (66%) Frame = +3 Query: 189 IATPIQLHPEKAKLDTLTQPF 251 I P+ ++PE+A+ ++PF Sbjct: 519 IVAPLTINPERAEFIEFSKPF 539 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 21.8 bits (44), Expect = 6.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +3 Query: 288 HCRRVLVLMTSLRTHTAITGVIRPHS 365 HC R V + +LR H + RP++ Sbjct: 42 HCDRQFVQVANLRRHLRVHTGERPYA 67 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/32 (25%), Positives = 14/32 (43%) Frame = +3 Query: 426 WEVTFKFI*MKTHLVTIVLIVKMGLTLFDYPW 521 W +T I + I+ V + ++YPW Sbjct: 495 WTITTPAICVGVFTFNIIKFVPVKYLTYEYPW 526 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/32 (25%), Positives = 14/32 (43%) Frame = +3 Query: 426 WEVTFKFI*MKTHLVTIVLIVKMGLTLFDYPW 521 W +T I + I+ V + ++YPW Sbjct: 548 WTITTPAICVGVFTFNIIKFVPVKYLTYEYPW 579 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,903 Number of Sequences: 438 Number of extensions: 3884 Number of successful extensions: 71 Number of sequences better than 10.0: 64 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -