BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11a05 (209 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006A0BED Cluster: Transmembrane protein 39B.; n=1;... 31 3.9 UniRef50_A5N1R5 Cluster: Predicted methyl-accepting chemotaxis p... 31 6.8 >UniRef50_UPI00006A0BED Cluster: Transmembrane protein 39B.; n=1; Xenopus tropicalis|Rep: Transmembrane protein 39B. - Xenopus tropicalis Length = 424 Score = 31.5 bits (68), Expect = 3.9 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Frame = +2 Query: 5 VCTFYIHFCSYVF*CH----ILTMSIVYKLTTNKRFVDN 109 VC +HFC+YV+ C+ LT+ +VY + V N Sbjct: 241 VCLILLHFCNYVYTCYHKSIFLTVVVVYHVWVRNESVTN 279 >UniRef50_A5N1R5 Cluster: Predicted methyl-accepting chemotaxis protein; n=1; Clostridium kluyveri DSM 555|Rep: Predicted methyl-accepting chemotaxis protein - Clostridium kluyveri DSM 555 Length = 689 Score = 30.7 bits (66), Expect = 6.8 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 4 CLYVLYTFL*LRILMSYTYNVNCLQ-IDYEQKICRQLRRASFLF 132 C+ + FL L I++ Y N I+Y KIC+Q+ +F+F Sbjct: 307 CIAISIVFLILSIIIGYLIAKNISDPINYLTKICKQMANGNFVF 350 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,905,337 Number of Sequences: 1657284 Number of extensions: 2198277 Number of successful extensions: 4471 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4357 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4471 length of database: 575,637,011 effective HSP length: 48 effective length of database: 496,087,379 effective search space used: 10417834959 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -