BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte11a05 (209 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33610| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.1 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 25 7.1 >SB_33610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 26.6 bits (56), Expect = 3.1 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = +1 Query: 7 LYVLYTFL*LRILMSYTYNVNCLQIDYEQKICRQLRRASFL 129 ++ L F L LM +TYN+ +ID+ C +R L Sbjct: 22 IFSLTVFQTLSELMQHTYNIARFKIDFADNPCATVRTVFIL 62 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 25.4 bits (53), Expect = 7.1 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = -3 Query: 201 FIIIKYKCQ*RNAE*TRNVNKVMKKKRGTTQ 109 FI++ ++C + T+N+ K++KK R Q Sbjct: 243 FILLLFRCD-ATPDDTKNIGKLLKKNRTANQ 272 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,262,187 Number of Sequences: 59808 Number of extensions: 74423 Number of successful extensions: 153 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 16,821,457 effective HSP length: 48 effective length of database: 13,950,673 effective search space used: 292964133 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -