Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmte11a05
         (209 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex det...    20   3.7  
DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex det...    19   4.9  
DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex det...    19   4.9  
DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholi...    19   6.4  
AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive...    19   8.5  

>DQ325082-1|ABD14096.1|  179|Apis mellifera complementary sex
           determiner protein.
          Length = 179

 Score = 19.8 bits (39), Expect = 3.7
 Identities = 7/20 (35%), Positives = 10/20 (50%)
 Frame = +1

Query: 52  YTYNVNCLQIDYEQKICRQL 111
           Y YN NC ++ Y      Q+
Sbjct: 98  YNYNNNCKKLYYNINYIEQI 117


>DQ325132-1|ABD14146.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 19.4 bits (38), Expect = 4.9
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -1

Query: 35  NYKNVYKTY 9
           NYK +YK Y
Sbjct: 112 NYKKLYKNY 120


>DQ325131-1|ABD14145.1|  189|Apis mellifera complementary sex
           determiner protein.
          Length = 189

 Score = 19.4 bits (38), Expect = 4.9
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -1

Query: 35  NYKNVYKTY 9
           NYK +YK Y
Sbjct: 112 NYKKLYKNY 120


>DQ026032-1|AAY87891.1|  566|Apis mellifera nicotinic acetylcholine
           receptor alpha3subunit protein.
          Length = 566

 Score = 19.0 bits (37), Expect = 6.4
 Identities = 9/34 (26%), Positives = 17/34 (50%)
 Frame = +1

Query: 37  RILMSYTYNVNCLQIDYEQKICRQLRRASFLFHN 138
           R+L+   YN    + DY+ +   Q+ + S   H+
Sbjct: 351 RLLVMRRYNTPSKRSDYDSRPQYQIDKRSMGSHH 384


>AF004169-1|AAC13418.1|  371|Apis mellifera ultraviolet-sensitive
          opsin protein.
          Length = 371

 Score = 18.6 bits (36), Expect = 8.5
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = +1

Query: 7  LYVLYTFL 30
          LY+L+TFL
Sbjct: 54 LYILFTFL 61


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 54,444
Number of Sequences: 438
Number of extensions: 832
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 146,343
effective HSP length: 45
effective length of database: 126,633
effective search space used:  3039192
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 36 (19.4 bits)