BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p23 (693 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0506 - 24380469-24380632,24381737-24383893,24384488-243845... 30 2.0 03_05_0941 + 29008322-29009686,29009929-29010012,29010889-290110... 29 4.6 02_05_0796 + 31800256-31800528,31800635-31800758,31802642-318027... 29 4.6 02_02_0679 - 12875988-12876016,12876186-12876306,12877792-12877974 29 4.6 07_03_1248 - 25165929-25166891,25169159-25169473 28 6.1 06_01_0733 + 5405889-5405922,5405923-5405975,5406430-5406543,540... 28 8.1 >11_06_0506 - 24380469-24380632,24381737-24383893,24384488-24384541, 24384543-24384597,24384914-24384916,24385192-24385231, 24385576-24385632,24388124-24388412,24389764-24389771, 24390633-24390688,24391207-24391488,24391651-24391811, 24391887-24392121,24392860-24392943,24393022-24393117, 24393333-24394055,24396523-24396987 Length = 1642 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 636 LFDCGYIGPVRHEHDAQRREVKVYDDE 556 L D +G + H H+ R EV+VYDD+ Sbjct: 722 LLDPDDVGRLNHVHNDDREEVEVYDDD 748 >03_05_0941 + 29008322-29009686,29009929-29010012,29010889-29011052, 29011208-29011233,29011494-29011583,29012135-29012229, 29012328-29012495 Length = 663 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/52 (25%), Positives = 33/52 (63%), Gaps = 3/52 (5%) Frame = +1 Query: 325 LFVVDEFLKISLGLPVSSEEVPVLSNVTVDHVDILEPD---VNYYDANFYNA 471 L VD+ ++ L P++ E++ + S +T++HV+ + + ++ Y+ ++Y+A Sbjct: 158 LVTVDDVSEMHLVNPITGEQIALPSVITIEHVNPIFNESGAIHMYEYSWYSA 209 >02_05_0796 + 31800256-31800528,31800635-31800758,31802642-31802771, 31804336-31804414,31804848-31805133,31805273-31805385 Length = 334 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +3 Query: 294 TSGGATEGATVVCGG*VP*DQPRAARVQRGSASIEQCHSGPRRYIG 431 T GG + G P P R RGS +Q H GP+ Y+G Sbjct: 110 TIGGRRANCNIASMG-PPRPSPSRGRAPRGSLFPDQPHMGPQPYMG 154 >02_02_0679 - 12875988-12876016,12876186-12876306,12877792-12877974 Length = 110 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 87 VSIYVFFF*NKTNKAHLYKFNFM 155 +++Y+ F NKT+K HLYK + Sbjct: 83 ITVYIVFKLNKTSKKHLYKVGIL 105 >07_03_1248 - 25165929-25166891,25169159-25169473 Length = 425 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +3 Query: 555 PHHRI-PLP--HVAGHRVRVVLDQCIRNQTDTSSRTASHLASPLVQHP 689 PH+++ PL H++ H+V +LDQ + D+S+ + L S +Q P Sbjct: 298 PHYQVMPLNQNHLSFHQVEPMLDQVEEIKDDSSNDNVASLDSNCIQDP 345 >06_01_0733 + 5405889-5405922,5405923-5405975,5406430-5406543, 5407464-5407523,5408139-5408217,5410661-5410728, 5411198-5411302,5411887-5411994,5412087-5412279, 5412818-5412897,5413309-5413536,5414112-5414252, 5414341-5414466,5414561-5414611,5414879-5414956, 5415814-5415960,5416685-5417179 Length = 719 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +1 Query: 364 LPVSSEEVPVLSNVTVDHVDILEPDVN 444 LPV +E P++S T DHVDIL N Sbjct: 367 LPV--QETPLVSRKTSDHVDILREQFN 391 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,599,746 Number of Sequences: 37544 Number of extensions: 348716 Number of successful extensions: 1114 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1059 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1114 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -