BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p21 (496 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.098 SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.52 SB_37866| Best HMM Match : CDC37 (HMM E-Value=0.81) 30 1.2 SB_47070| Best HMM Match : V-set (HMM E-Value=0.085) 29 1.6 SB_25075| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_19362| Best HMM Match : M (HMM E-Value=0.0014) 29 1.6 SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) 29 2.1 SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_35649| Best HMM Match : M (HMM E-Value=6e-09) 29 2.8 SB_7993| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015) 28 3.7 SB_11530| Best HMM Match : 7tm_1 (HMM E-Value=5.1e-30) 28 3.7 SB_58390| Best HMM Match : DUF1167 (HMM E-Value=0) 28 4.9 SB_46788| Best HMM Match : LRR_1 (HMM E-Value=9.1e-12) 28 4.9 SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) 28 4.9 SB_46506| Best HMM Match : DUF827 (HMM E-Value=6.9) 28 4.9 SB_26701| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.9 SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) 27 6.4 SB_29959| Best HMM Match : GoLoco (HMM E-Value=5.4e-17) 27 8.5 SB_5496| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 27 8.5 >SB_56568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 33.5 bits (73), Expect = 0.098 Identities = 27/100 (27%), Positives = 51/100 (51%) Frame = +3 Query: 96 FEKLQKDGKNSVDNIIKWMKDSKIIDEVKASEEKARKLFEGVPDIXNIDINKLKEVINKM 275 + L+K+ +N V + K K + + + E+ + L + V D+ I + K + +NK+ Sbjct: 194 YNSLRKEKENLVSELTK--KFEMLEGQKSSLVEENKVLQDSVKDL-KIRLKKSNQDLNKI 250 Query: 276 AAEQKKNVEELTTMLEKQPPKVLDALQAGASAFKAALEKK 395 E K +EE+ M++K+ K L+ S K+ LEK+ Sbjct: 251 TEELKSTLEEI-EMVKKKGNKDLEEKVGVLSKEKSNLEKE 289 >SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 31.1 bits (67), Expect = 0.52 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +3 Query: 174 EVKASEEKARKLFEGVPDIXNIDINKLKEVINKMAAEQKKNVEELTTMLEKQ 329 E+ E+ RKL +I+KL E + K A Q+K EEL EK+ Sbjct: 715 EMNRKNERERKLLREENKKLQSEIDKLSESLEKSVAVQRKMEEELRDSSEKR 766 >SB_37866| Best HMM Match : CDC37 (HMM E-Value=0.81) Length = 461 Score = 29.9 bits (64), Expect = 1.2 Identities = 20/73 (27%), Positives = 38/73 (52%) Frame = +3 Query: 108 QKDGKNSVDNIIKWMKDSKIIDEVKASEEKARKLFEGVPDIXNIDINKLKEVINKMAAEQ 287 QK+ KN ++N +K SKI+ +K+S +KL + N+ +K+ K + E Sbjct: 316 QKEKKNKINNDVKSKSKSKIVKILKSS----KKLKKDGRKAKNLKDSKVNLEKAKNSTED 371 Query: 288 KKNVEELTTMLEK 326 K ++ E+ + E+ Sbjct: 372 KGSIAEIAHLKEQ 384 >SB_47070| Best HMM Match : V-set (HMM E-Value=0.085) Length = 260 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +3 Query: 120 KNSVDNIIKWMKDSKIIDEVKASEEK 197 +N +D+I W+KD+K+IDE + E+K Sbjct: 36 RNPIDHIA-WIKDNKLIDETFSPEKK 60 >SB_25075| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 267 Score = 29.5 bits (63), Expect = 1.6 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +3 Query: 120 KNSVDNIIKWMKDSKIIDEVKASEEK 197 +N +D+I W+KD+K+IDE + E+K Sbjct: 51 RNPIDHIA-WIKDNKLIDETFSPEKK 75 >SB_19362| Best HMM Match : M (HMM E-Value=0.0014) Length = 722 Score = 29.5 bits (63), Expect = 1.6 Identities = 22/82 (26%), Positives = 37/82 (45%) Frame = +3 Query: 21 KQQHLDSVXXXXXXXXXXXXXMDQFFEKLQKDGKNSVDNIIKWMKDSKIIDEVKASEEKA 200 K++H+DSV MDQ E ++K+ + + + ++ + + A E Sbjct: 379 KEKHIDSVKKDNQG-------MDQAMEAMKKELVATRSEMQRLKREHERLQRENAEREID 431 Query: 201 RKLFEGVPDIXNIDINKLKEVI 266 R EGV N IN+LKE + Sbjct: 432 RLTTEGVTKANNSKINQLKEQV 453 >SB_44844| Best HMM Match : DUF164 (HMM E-Value=0.094) Length = 332 Score = 29.1 bits (62), Expect = 2.1 Identities = 20/76 (26%), Positives = 39/76 (51%) Frame = +3 Query: 168 IDEVKASEEKARKLFEGVPDIXNIDINKLKEVINKMAAEQKKNVEELTTMLEKQPPKVLD 347 I+++K E+ + + N ++ KLKE I+ + E+K+ EEL ++ K L Sbjct: 48 IEKLKQEIEQKEREINNLRKTRNDEVKKLKERIHVLEEEKKRLEEELASVKYK-----LT 102 Query: 348 ALQAGASAFKAALEKK 395 AL++ A A +++ Sbjct: 103 ALESEVKALSNANDRQ 118 >SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6863 Score = 29.1 bits (62), Expect = 2.1 Identities = 22/96 (22%), Positives = 50/96 (52%), Gaps = 3/96 (3%) Frame = +3 Query: 99 EKLQKDGKNSVDNIIKWMKDSKIIDEVKASEEKARKLFEGV-PDIXNIDINKLK--EVIN 269 ++++KD +N + II+WM + I E + L V ++ ++ L+ +++ Sbjct: 5063 QQIEKDLENEISEIIEWMNEVARITEKETLTRHDDTLLSSVESNLDGLEDKSLRVSQLVE 5122 Query: 270 KMAAEQKKNVEELTTMLEKQPPKVLDALQAGASAFK 377 KM E +N ++ +++++ ++LD L+ AFK Sbjct: 5123 KM-EELPENKQK--QVIKEKLSQLLDQLKKQKVAFK 5155 >SB_35649| Best HMM Match : M (HMM E-Value=6e-09) Length = 1279 Score = 28.7 bits (61), Expect = 2.8 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = +3 Query: 96 FEKLQKDGKNSVDNIIKWMKDSKIIDEVKASEEKARKLFEGVPDIXNIDINKLKEVINKM 275 F+K+ D ++ + + + K+I+E + +K + D + I L+E N M Sbjct: 25 FQKVYSDNESLQKRVSELEEHQKVIEETNETLKKQHETVLFEKDELTLTIKTLQEEFNTM 84 Query: 276 AAEQKK---NVEELTTMLEKQ 329 E +K +E L T ++ Q Sbjct: 85 LQEYEKLKAKMENLPTEMDGQ 105 >SB_7993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 28.7 bits (61), Expect = 2.8 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Frame = +3 Query: 108 QKDGKNSVDNIIKWMKDSKIIDEVKASEEKARKLFEGV-PDIXNIDINKLKEVINKMAAE 284 +KDGK V + +S I +E+ + EGV ++D N+ K V + AE Sbjct: 457 RKDGKEEVTPPLNEQTESDISNEINKGPDSKGGSLEGVGGKDASVDANE-KSVPKQETAE 515 Query: 285 QKKNVEELTTMLEKQ 329 +K N E + ++++ Sbjct: 516 EKDNSETTESNVQEE 530 >SB_41920| Best HMM Match : Filamin (HMM E-Value=0.00015) Length = 600 Score = 28.3 bits (60), Expect = 3.7 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 214 SNNFRAFSSEAFTSSIILESFIHLIMLSTLFFPSFCSFSKNW 89 SN+ R F S F + ++ + S++ FPS SF K+W Sbjct: 179 SNSLRIFFSAVFLFIVYYKTADDISSRSSVTFPSLDSFIKDW 220 >SB_11530| Best HMM Match : 7tm_1 (HMM E-Value=5.1e-30) Length = 455 Score = 28.3 bits (60), Expect = 3.7 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +3 Query: 189 EEKARKLFEGVPDIXNIDINKLKEVINKMAAEQKKNVEELTTMLEK 326 ++K+ LFE VPD+ + N K+ I K E+ ++E +LEK Sbjct: 52 KKKSCALFE-VPDVIPVMTNNYKDSIMKGVKEEAYSLESSQELLEK 96 >SB_58390| Best HMM Match : DUF1167 (HMM E-Value=0) Length = 734 Score = 27.9 bits (59), Expect = 4.9 Identities = 25/90 (27%), Positives = 42/90 (46%), Gaps = 2/90 (2%) Frame = +3 Query: 141 IKWMKDSKIIDEVKASEEKARKL-FEGVPDIXNIDINKLKEVINKMAAEQKKNVEELTT- 314 +KW+ + +I +K +EK RKL E N+ + K ++++ V + T Sbjct: 331 VKWITLTAVISALKGLQEKIRKLELERTDAEDNLKRLAAESKHYKEVLQKEQTVRSVNTG 390 Query: 315 MLEKQPPKVLDALQAGASAFKAALEKK*PY 404 ++ KQ + D L A A A LEK+ Y Sbjct: 391 VISKQNEALQDDLHA-AEARCNLLEKQLDY 419 >SB_46788| Best HMM Match : LRR_1 (HMM E-Value=9.1e-12) Length = 139 Score = 27.9 bits (59), Expect = 4.9 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 273 MAAEQKKNVEELTTMLEKQPPKVLDALQAGASAFKAALEKK*PYQHHV-KT*FSSS 437 + A + K V E+ T LEK +L + GA + + Y HHV KT FS S Sbjct: 73 LEANELKIVPEVVTKLEKLQVLILSDNEIGALPADLGIPGRAFYSHHVWKTSFSWS 128 >SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) Length = 1292 Score = 27.9 bits (59), Expect = 4.9 Identities = 20/74 (27%), Positives = 31/74 (41%) Frame = +3 Query: 105 LQKDGKNSVDNIIKWMKDSKIIDEVKASEEKARKLFEGVPDIXNIDINKLKEVINKMAAE 284 +Q DG + S+++D + +L E I +D + LKE +NK AA Sbjct: 792 VQNDGSLKLQQDEMQKASSELLDTKSTMDALRAQLVEKQNKISELD-SLLKETVNKNAAS 850 Query: 285 QKKNVEELTTMLEK 326 K E L+K Sbjct: 851 LKACEERYNEQLDK 864 >SB_46506| Best HMM Match : DUF827 (HMM E-Value=6.9) Length = 261 Score = 27.9 bits (59), Expect = 4.9 Identities = 15/69 (21%), Positives = 35/69 (50%) Frame = +3 Query: 162 KIIDEVKASEEKARKLFEGVPDIXNIDINKLKEVINKMAAEQKKNVEELTTMLEKQPPKV 341 K+ +E+K + + + +P+ + + K K K +E+ N+E++ + L + ++ Sbjct: 180 KLAEELKENLNSLKSVVAQMPEELSTYVEKAKFKTTKFGSEEMTNMEKMQSKLMETEMQL 239 Query: 342 LDALQAGAS 368 ALQ A+ Sbjct: 240 DMALQRAAA 248 >SB_26701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 409 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 179 ESFRGEGAKVVRRRSGYXQYRHK*IERGYQQNGRRTEEKR 298 +++RG G + RR Y YR E G GR E+ R Sbjct: 347 DNYRGRGDEYRRRDEDYRGYREDRREHGEDYRGRGREKAR 386 >SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) Length = 1447 Score = 27.5 bits (58), Expect = 6.4 Identities = 18/74 (24%), Positives = 42/74 (56%), Gaps = 1/74 (1%) Frame = +3 Query: 99 EKLQKDGKNSVDNIIKWMKDSKI-IDEVKASEEKARKLFEGVPDIXNIDINKLKEVINKM 275 +K+QK + + +IK +D K+ +DE + SE+ K + + + +++++E+ KM Sbjct: 445 QKMQKQHNDDMAELIKRFEDEKMKLDEARESEK--AKTTQHLTKAERV-LSEMEEIKLKM 501 Query: 276 AAEQKKNVEELTTM 317 A +++ + TT+ Sbjct: 502 KAIEQEKLSLQTTV 515 >SB_29959| Best HMM Match : GoLoco (HMM E-Value=5.4e-17) Length = 774 Score = 27.1 bits (57), Expect = 8.5 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +3 Query: 108 QKDG-KNSVDNIIKWMKDSKIIDEVKASEEKARKLFEGVPDIXNIDINKLKEV 263 +K+G KNS + W KD +I D++ + +KA + + ++D K +E+ Sbjct: 430 EKEGLKNSSYAAVYWAKDYQIPDDLVKNMKKAAAILKRYGKPISLDTEKPREL 482 >SB_5496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1352 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 170 YYFRIFHPFDNVVDAVLSVFL*FF 99 YYFR HP+ ++ + L VFL FF Sbjct: 54 YYFR--HPWSRIITSYLVVFLNFF 75 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 27.1 bits (57), Expect = 8.5 Identities = 17/69 (24%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +3 Query: 162 KIIDEVKASEEKARKL---FEGVPDIXNIDINKLKEVINKMAAEQKKNVEELTTMLEKQP 332 K +DEV + ++ L EG+ + ++ ++ +++ N +A E++K+ + EKQ Sbjct: 3046 KTLDEVTPTAQRVPHLNNTVEGLQEALELERSRAEDLNNALAGERQKSKLNASMEAEKQL 3105 Query: 333 PKVLDALQA 359 + D L A Sbjct: 3106 REQTDRLVA 3114 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,897,716 Number of Sequences: 59808 Number of extensions: 195715 Number of successful extensions: 577 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 552 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 576 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1062812967 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -