BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p21 (496 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 23 1.3 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 3.1 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 22 3.1 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 23.4 bits (48), Expect = 1.3 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +3 Query: 321 EKQPPKVLDALQAGASAFKAALEK 392 ++ PKVL A++ GAS + ++ K Sbjct: 434 KQNKPKVLHAIRRGASILRVSMPK 457 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 22.2 bits (45), Expect = 3.1 Identities = 16/68 (23%), Positives = 27/68 (39%), Gaps = 4/68 (5%) Frame = -1 Query: 274 ILLITSFNLFMSILXISG----TPSNNFRAFSSEAFTSSIILESFIHLIMLSTLFFPSFC 107 I+ I F+L +I + G P N A ++ F ++ S++ + F P F Sbjct: 172 IIAIWLFSLGWTIAPMFGWNRYVPEGNMTACGTDYFNRGLLSASYLVCYGIWVYFVPLFL 231 Query: 106 SFSKNWSI 83 W I Sbjct: 232 IIYSYWFI 239 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 22.2 bits (45), Expect = 3.1 Identities = 16/68 (23%), Positives = 27/68 (39%), Gaps = 4/68 (5%) Frame = -1 Query: 274 ILLITSFNLFMSILXISG----TPSNNFRAFSSEAFTSSIILESFIHLIMLSTLFFPSFC 107 I+ I F+L +I + G P N A ++ F ++ S++ + F P F Sbjct: 48 IIAIWLFSLGWTIAPMFGWNRYVPEGNMTACGTDYFNRGLLSASYLVCYGIWVYFVPLFL 107 Query: 106 SFSKNWSI 83 W I Sbjct: 108 IIYSYWFI 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,942 Number of Sequences: 438 Number of extensions: 1764 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13667319 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -