BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p20 (703 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4A7Z6 Cluster: Lppt protein; n=3; Mycoplasma hyopneumo... 33 6.8 UniRef50_Q0ET18 Cluster: Radical SAM; n=4; Clostridia|Rep: Radic... 33 9.0 >UniRef50_Q4A7Z6 Cluster: Lppt protein; n=3; Mycoplasma hyopneumoniae|Rep: Lppt protein - Mycoplasma hyopneumoniae (strain 7448) Length = 957 Score = 33.1 bits (72), Expect = 6.8 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -1 Query: 328 SSMPIIRLLCISVFHRDSFIMSFEVK 251 +S P LLC+S F+RD FI+ E+K Sbjct: 591 TSFPTNTLLCLSTFYRDKFILKLELK 616 >UniRef50_Q0ET18 Cluster: Radical SAM; n=4; Clostridia|Rep: Radical SAM - Thermoanaerobacter ethanolicus X514 Length = 282 Score = 32.7 bits (71), Expect = 9.0 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = +3 Query: 153 ILFSK*SYKKKCNGFLYTSKIAYNYFSDMVLRFFTSKLIMKESR*NTLIHNSRII 317 I+F + +Y KK +L+ + YNY SD+V+RF + I+ + T+ ++ I Sbjct: 208 IVFGRLNYNKKVREYLWYKEF-YNYCSDVVIRFCEQRNILYHIKDGTITDDAPYI 261 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 651,807,982 Number of Sequences: 1657284 Number of extensions: 13256609 Number of successful extensions: 27477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27470 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 55785129165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -