BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p15 (709 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 24 4.1 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 24 4.1 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 24.2 bits (50), Expect = 4.1 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 632 PVTAMVAVENTHNYCGGKVLPL 697 P+ ++V VENT NY V L Sbjct: 275 PIQSIVGVENTWNYTAADVADL 296 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 24.2 bits (50), Expect = 4.1 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +2 Query: 431 NLIAIMVHCNKRGSEAFVGDLSHIYKYEVGGASHLAGVMLSTVANKP-DGTFDLQE 595 N+I ++ HC G + + + VG SH ++L+ A P D +D E Sbjct: 222 NIIVVLSHCGLDGDKQLAEEAGDLIDVIVGAHSH--SLLLNKDAKVPYDTKYDTIE 275 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 657,437 Number of Sequences: 2352 Number of extensions: 13020 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -