BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p14 (370 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22295| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 >SB_22295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 27.1 bits (57), Expect = 4.8 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +1 Query: 73 INCQGDHIYL*KGFWKSMERRYRVILTR 156 INC GD + + +W S ER++ + + + Sbjct: 288 INCPGDDAFSIRDYWGSEERKFPIAVNQ 315 >SB_59006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1211 Score = 26.6 bits (56), Expect = 6.3 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -3 Query: 173 KTSNTSRVKITLYLLSM-LFQKPFYRYMWSPWQ 78 K N S++++T LS+ +F+ ++ Y W PWQ Sbjct: 22 KALNFSKMQLTPSRLSLWVFRNVYFEY-WEPWQ 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,156,289 Number of Sequences: 59808 Number of extensions: 154503 Number of successful extensions: 340 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 340 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 594991920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -