BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p12 (714 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7549| Best HMM Match : TraB (HMM E-Value=6.79994e-41) 105 5e-23 >SB_7549| Best HMM Match : TraB (HMM E-Value=6.79994e-41) Length = 478 Score = 105 bits (251), Expect = 5e-23 Identities = 49/118 (41%), Positives = 77/118 (65%) Frame = +2 Query: 323 RCFRELCRQRVSXXXXXXXXXXXXAKNFDSKKLKQAVKGQNLVTGMLHAMLLKTYADIAK 502 R ELC+ R+ AKN D +KLK A+K +V G++ +LL A I + Sbjct: 187 RVLVELCKSRIDILKYDEEFLLREAKNIDMQKLKLAIKQSGVVGGIMQVLLLSMSAHITQ 246 Query: 503 ELGVAPGGEFRRAYHEMQKIPGCKLYLGDRPIQITIARAFQSLSVYELGQVLYHISTS 676 +LG+APGGEFR AY E +K+ GC+++LGDRPIQ+T++RA +L+V++ ++ +H+ T+ Sbjct: 247 QLGMAPGGEFRAAYREARKL-GCQVHLGDRPIQVTLSRAMAALTVWQKVKLAWHLLTT 303 Score = 37.1 bits (82), Expect = 0.014 Identities = 16/38 (42%), Positives = 25/38 (65%) Frame = +3 Query: 234 LPKSATLLQNDKQATVVLLGTVHFSKQSIEDVSENFVA 347 LP++ T L+ + V ++GT HFSK+S EDV++ A Sbjct: 145 LPETVTKLETPEGCVVYVIGTAHFSKESQEDVAKTIQA 182 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,939,984 Number of Sequences: 59808 Number of extensions: 436020 Number of successful extensions: 889 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 840 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 888 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -