BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p05 (736 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL391121-3|CAI40861.1| 550|Homo sapiens tripartite motif-contai... 30 7.5 >AL391121-3|CAI40861.1| 550|Homo sapiens tripartite motif-containing 8 protein. Length = 550 Score = 30.3 bits (65), Expect = 7.5 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +3 Query: 327 CETKERNRETGILLSRQDKNTAEISTIVSQTYKHEYLQKLIEQWKNSLE 473 C+ + R E +L+ +QD+ I Q YK E ++L+E+ N L+ Sbjct: 180 CDVEIRRNEIRMLMKQQDRLEEREQDIEDQLYKLESDKRLVEEKVNQLK 228 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,927,587 Number of Sequences: 237096 Number of extensions: 1657733 Number of successful extensions: 6725 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6725 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8735159784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -