BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p04 (714 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F12.09 |rdp1|rdr1|RNA-directed RNA polymerase Rdp1|Schizosa... 26 6.1 SPAC17G8.11c |||mannosyltransferase complex subunit |Schizosacch... 25 8.1 >SPAC6F12.09 |rdp1|rdr1|RNA-directed RNA polymerase Rdp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1215 Score = 25.8 bits (54), Expect = 6.1 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -1 Query: 477 CTSVKTETNLILI*VFKRICIIF 409 C TE+NL++ FK++C++F Sbjct: 200 CGITVTESNLLVYFNFKKLCVLF 222 >SPAC17G8.11c |||mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 356 Score = 25.4 bits (53), Expect = 8.1 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +1 Query: 328 H*NFYVVLYVPLSAFAIAPVDYTLIV*EYDTYPFEYSN*NQIRF 459 H ++ VL+ S DY + +YD+YP+ + +R+ Sbjct: 85 HPDYEYVLWTDESMREFIATDYPWFLTQYDSYPYNIERADVVRY 128 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,751,412 Number of Sequences: 5004 Number of extensions: 54820 Number of successful extensions: 101 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 98 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 101 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -