BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p04 (714 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0561 + 19485218-19485242,19485323-19486467,19487354-194874... 29 2.8 10_02_0112 + 5385660-5385821,5386337-5386876 28 8.5 >07_03_0561 + 19485218-19485242,19485323-19486467,19487354-19487476, 19487553-19487626,19487886-19487946,19488285-19488370, 19488795-19488864,19489026-19489122,19489342-19489481, 19490225-19490308,19490313-19490346,19491833-19491951 Length = 685 Score = 29.5 bits (63), Expect = 2.8 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +3 Query: 291 KYESIIVTIT*ITLEFLRCFVCTPLRVCYCTSRLHPNSIGI 413 KY+ +I T + I ++ + + R CYC +PN + + Sbjct: 274 KYDFVITTYSTIEADYRKHIMPPKTRCCYCDKLFYPNKLKV 314 >10_02_0112 + 5385660-5385821,5386337-5386876 Length = 233 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 612 IIFKLRPGQILHLFRSNGVCICVETI 689 I+F + G LF+ NGVC+C+ T+ Sbjct: 23 ILFYMIYGAQYSLFQCNGVCMCLSTL 48 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,571,824 Number of Sequences: 37544 Number of extensions: 273400 Number of successful extensions: 414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 404 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -