BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p04 (714 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 26 1.4 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 24 5.4 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 25.8 bits (54), Expect = 1.4 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +1 Query: 334 NFYVVLYVPLSAFAIAPVDYTLIV*EYDTYPFEYSN*NQI 453 NFY L + + + PV Y ++ E + +SN N+I Sbjct: 600 NFYFALLLTMLFLCVLPVSYAIVFLEPSWHCGPFSNSNRI 639 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = -1 Query: 561 NTTDFSFLL*TQTLVFLSIYLTNLLHMYCTSVKTETNLIL 442 N D +++L + ++F +L C SVK E N+++ Sbjct: 40 NVEDTNWVLTSSFIIFTMQTGFGMLESGCVSVKNEVNIMM 79 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 695,432 Number of Sequences: 2352 Number of extensions: 13211 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -