BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p03 (513 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 22 4.3 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 5.7 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 21 9.9 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 21 9.9 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.8 bits (44), Expect = 4.3 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 144 KLTFKRSHNGLKNKTPGVRLSNVTMPLF*SPA*EYRLSFTS 266 K+T LKN G+ LS VT L+ SP + L + + Sbjct: 237 KMTIDGESFTLKNGICGMALSPVTNNLYYSPLASHGLYYVN 277 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 5.7 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +3 Query: 144 KLTFKRSHNGLKNKTPGVRLSNVTMPLF*SP 236 KLT +KN G+ LS VT L+ SP Sbjct: 242 KLTVAGESFTVKNGIYGIALSPVTNNLYYSP 272 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 277 RISAKYDSMAYVKEAF 324 R+SAKYDS K+ + Sbjct: 100 RLSAKYDSTGEYKKRY 115 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 20.6 bits (41), Expect = 9.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 277 RISAKYDSMAYVKEAF 324 R+SAKYDS K+ + Sbjct: 100 RLSAKYDSTGEYKKRY 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,251 Number of Sequences: 438 Number of extensions: 1795 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14232156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -