BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p02 (699 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 24 1.0 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 22 5.5 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 21 9.7 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 9.7 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 24.2 bits (50), Expect = 1.0 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -3 Query: 571 YIC*LFLEHSIHMHVVLPWRVMVLSEGC 488 Y+C + L SI ++++ +MVL GC Sbjct: 727 YLCPVLLRVSILRNIIVGTLMMVLGTGC 754 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 154 IQFVIRRVYLYDTNTNTYYI*CVIVFLKVEDQNTLF 261 IQ V+R + N Y++ ++ LK +TLF Sbjct: 64 IQLVVRNLLDISLYLNAYHVFVTMMTLKRHKWSTLF 99 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -1 Query: 591 HFICIFFIFVN 559 HFIC+F I +N Sbjct: 31 HFICLFPITIN 41 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.0 bits (42), Expect = 9.7 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = -1 Query: 591 HFICIFFIFVNYFL 550 HF C F IF + L Sbjct: 168 HFFCAFIIFTMHLL 181 Score = 21.0 bits (42), Expect = 9.7 Identities = 9/33 (27%), Positives = 18/33 (54%) Frame = -3 Query: 298 FCSLVLTMFFYYEIMCFGLLPLKTL*HTIYSMY 200 +C+L++ + YY F + P T + +S+Y Sbjct: 289 YCALIILLCIYYFCRAFIIFP--THFYCAFSLY 319 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,829 Number of Sequences: 336 Number of extensions: 2929 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -