BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10p01 (291 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 22 1.2 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 20 6.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 20 6.2 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 19 8.2 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 19 8.2 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 22.2 bits (45), Expect = 1.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -2 Query: 194 LAFHRRFPVKRFF 156 L FH P+KRFF Sbjct: 163 LIFHSVLPIKRFF 175 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 19.8 bits (39), Expect = 6.2 Identities = 10/44 (22%), Positives = 16/44 (36%) Frame = -2 Query: 134 PYISDGANVVALTNPRSHIKTLAEIEVPTRFGKNKTFSPRWRSI 3 P+I N L K +AE + N+ RW ++ Sbjct: 477 PHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHAL 520 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 19.8 bits (39), Expect = 6.2 Identities = 10/44 (22%), Positives = 16/44 (36%) Frame = -2 Query: 134 PYISDGANVVALTNPRSHIKTLAEIEVPTRFGKNKTFSPRWRSI 3 P+I N L K +AE + N+ RW ++ Sbjct: 369 PHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHAL 412 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 19.4 bits (38), Expect = 8.2 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -2 Query: 74 TLAEIEVPTRFGKNKTFSPRWR 9 T++ IEV ++ TF+ W+ Sbjct: 431 TVSNIEVQSQGSSKNTFNTFWQ 452 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 19.4 bits (38), Expect = 8.2 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -2 Query: 74 TLAEIEVPTRFGKNKTFSPRWR 9 T+ IEV + GK S W+ Sbjct: 431 TVTNIEVQAKGGKPNVLSTFWQ 452 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,812 Number of Sequences: 336 Number of extensions: 1530 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 48 effective length of database: 106,457 effective search space used: 5109936 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 37 (19.9 bits)
- SilkBase 1999-2023 -