BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o24 (460 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8IEM0 Cluster: Putative uncharacterized protein PF13_0... 33 2.2 UniRef50_Q4XTH8 Cluster: Putative uncharacterized protein; n=1; ... 33 3.0 UniRef50_Q4XSF7 Cluster: Putative uncharacterized protein; n=6; ... 33 3.9 UniRef50_Q4X5Z6 Cluster: Putative uncharacterized protein; n=1; ... 31 9.0 >UniRef50_Q8IEM0 Cluster: Putative uncharacterized protein PF13_0050; n=3; cellular organisms|Rep: Putative uncharacterized protein PF13_0050 - Plasmodium falciparum (isolate 3D7) Length = 1327 Score = 33.5 bits (73), Expect = 2.2 Identities = 19/63 (30%), Positives = 31/63 (49%) Frame = -1 Query: 262 VYPPVLANHYDMVPNYRGIWIYY*GGHNSRYKTFMSCRYVKISKYNKYFVQTKEACASKN 83 +YPP NH+ N++ YY HN K++++ +K K + F + KE N Sbjct: 268 IYPPQ-GNHFMNAQNHKQDKNYYINNHNDNKKSYINYNRLKCIK-ERLFNKNKEKKIINN 325 Query: 82 LIF 74 L+F Sbjct: 326 LLF 328 >UniRef50_Q4XTH8 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 86 Score = 33.1 bits (72), Expect = 3.0 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = -1 Query: 238 HYDMVPNYRGIWIYY*GGHNSRYKTFMSCRYVKISKYNKYFVQTKEACASKNLIF 74 H+D Y W+ Y H+S + Y+ I +N +F + K+ +K +F Sbjct: 21 HFDHTDGYYAYWVVYIFAHHSFIPLPRNGAYIYIHSFNDFFEKIKKRLKNKEYLF 75 >UniRef50_Q4XSF7 Cluster: Putative uncharacterized protein; n=6; Eukaryota|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 1625 Score = 32.7 bits (71), Expect = 3.9 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -1 Query: 190 GGHNSRYKTFMSCRYVKISK-YNKYFVQTK 104 GG N K ++ C+Y+KISK NKYF K Sbjct: 963 GGSNFSGKKYVRCKYIKISKNMNKYFYMYK 992 >UniRef50_Q4X5Z6 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 101 Score = 31.5 bits (68), Expect = 9.0 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = -1 Query: 238 HYDMVPNYRGIWIYY*GGHNSRYKTFMSCRYVKISKYNKYFVQTKEACASKNLI 77 H+D Y W+ Y H+S + Y+ I +N +F + K+ +K+ I Sbjct: 21 HFDHTDGYYAYWVVYIFAHHSFIPLPRNGAYIYIHSFNDFFEKIKKRLKNKDQI 74 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 370,540,077 Number of Sequences: 1657284 Number of extensions: 6086600 Number of successful extensions: 10669 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10668 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 24351434270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -