BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o24 (460 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 26 0.22 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 2.8 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 25.8 bits (54), Expect = 0.22 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -2 Query: 177 LDTKHSCRVVM*RYQNTTNTSFKRKKRAHLKTSSFIKW 64 LD+K S R+ M NT+ S +K+ TS I W Sbjct: 362 LDSKVSARIEMNEDDNTSLVSLDKKQYTWRHTSVLIGW 399 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 2.8 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -2 Query: 267 FEFTHPSLRTIMIW 226 F F H SL+ +++W Sbjct: 103 FYFVHESLKNVLLW 116 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,539 Number of Sequences: 438 Number of extensions: 2220 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12189771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -