BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o22 (690 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 25 0.77 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 24 1.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.1 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 22 4.1 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 24.6 bits (51), Expect = 0.77 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = +1 Query: 481 MVQVKRDTRTGLSKGFGFIKFAEYEAQLRALGRRHMIDGRWCDVRIPN 624 + + R+ L G GF+K E E L RH++ C + P+ Sbjct: 608 VTSLNREEIKRLDNGVGFLKVKENEITLLVATVRHVMAPSTCQPQNPD 655 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 23.8 bits (49), Expect = 1.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 548 SANLMKPKPLDSPVRVSRFT*TISKSPKEEK*SRTASS 435 +ANL++P P SP+ S T S+ K + ASS Sbjct: 104 AANLLRPHPYLSPLFHSAAPRTASRETKSSESDSGASS 141 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 614 RTSHQRPSIMCRRPNARS 561 R S RPS+ R PN ++ Sbjct: 1432 RVSQARPSVQLRYPNGKA 1449 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 614 RTSHQRPSIMCRRPNARS 561 R S RPS+ R PN ++ Sbjct: 1432 RVSQARPSVQLRYPNGKA 1449 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 22.2 bits (45), Expect = 4.1 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 363 TRGIAAASTTMLRSYSSRLTMEDDRRSCTRLLLLL 467 TR IAA ++ + S S + + DD L LL Sbjct: 247 TRRIAAVASEKVTSEKSWIALNDDYNRLCHLCFLL 281 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,686 Number of Sequences: 336 Number of extensions: 2927 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -