BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o19 (682 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1527.03 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 27 3.3 SPAC343.06c |||scramblase|Schizosaccharomyces pombe|chr 1|||Manual 26 5.8 SPCC191.03c |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 25 7.7 >SPAC1527.03 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 475 Score = 26.6 bits (56), Expect = 3.3 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +3 Query: 474 LRNKTLRTSKRRKVGPKANGRNTWIT 551 + ++ L ++ + PKANG+ W+T Sbjct: 124 VEDRKLSDDSQKPLAPKANGKEKWVT 149 >SPAC343.06c |||scramblase|Schizosaccharomyces pombe|chr 1|||Manual Length = 381 Score = 25.8 bits (54), Expect = 5.8 Identities = 11/43 (25%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 206 NILSVPRKYIIDTGEGMPAYTPRGIRKSALN-SQLSDRVHDVS 331 N + +PR++ DTG + +T ++N +QL H ++ Sbjct: 232 NFMGLPREFFTDTGNYVLRFTSTSAANGSVNENQLLQAAHGIA 274 >SPCC191.03c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 117 Score = 25.4 bits (53), Expect = 7.7 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -2 Query: 543 MCFFHSLSVQPFFFLTSLVSCFLRSI 466 + F HSL V FF + SC +RS+ Sbjct: 64 LVFLHSLIVARFFVASKSRSCIVRSL 89 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,862,864 Number of Sequences: 5004 Number of extensions: 60751 Number of successful extensions: 155 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -