BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o18 (413 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 23 4.4 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 5.8 AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 23 5.8 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 23.0 bits (47), Expect = 4.4 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +2 Query: 128 IVRRLGSYRTKDEYDCYVEGYVKCFWSLCDRHNS 229 I R G T ++ ++EG K C RH + Sbjct: 287 ITRYSGQISTTEQSVTHIEGRCKAIGDSCTRHEN 320 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 22.6 bits (46), Expect = 5.8 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = -3 Query: 186 PST*QSYSSLVLYDPSLRTI 127 PS+ +YSS+ Y+P+ R++ Sbjct: 239 PSSSPAYSSITHYEPTARSL 258 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 22.6 bits (46), Expect = 5.8 Identities = 9/31 (29%), Positives = 18/31 (58%) Frame = -2 Query: 400 LADEFFS*NKTVFYSVVHSYSKNIILKSLCV 308 +AD + N + ++V+SY+ + K+ CV Sbjct: 315 IADHLNTTNHAIVQTLVNSYNPTLAPKACCV 345 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 377,321 Number of Sequences: 2352 Number of extensions: 6621 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 33777477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -