BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o14 (577 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14297| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_21227| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 SB_20830| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_14297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 33.1 bits (72), Expect = 0.17 Identities = 12/29 (41%), Positives = 24/29 (82%) Frame = -3 Query: 263 EEIESISKRLENGEISEDNSTDNEDDINY 177 EE ESI+ + +NG+ S+++S+D ED++++ Sbjct: 221 EEFESIATQCKNGKKSDNDSSDTEDELDF 249 >SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4700 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -3 Query: 287 RNLSKMRPEEIESISKRLENGEISEDNSTDNEDDI 183 RNL K + +E+ ++RLENG + ++ DD+ Sbjct: 3258 RNLLKKKSKELTQKTERLENGLLKLQSTAQQVDDL 3292 >SB_21227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 81 CRRICIQVWVSGKIT--YILFIF*LHQTISLARIIVYVIFIVGRIV 212 C+RI I + ++ IT YI+ I + I+L ++Y+I I+ ++ Sbjct: 5 CKRIDISIIITIIITVIYIIIIITVIYNITLIITVIYIIIIINIVI 50 >SB_20830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 27.5 bits (58), Expect = 8.3 Identities = 13/42 (30%), Positives = 18/42 (42%) Frame = +2 Query: 137 HLLAPSDDLFGSNNSLCHLHCR*NCLPKFHHFLTALICSQSL 262 H +F N+ LC H R FHHF A+ + +L Sbjct: 114 HFTPSEKQIFKENSKLCDAHHRRLLEEHFHHFSKAMGAAHTL 155 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,488,991 Number of Sequences: 59808 Number of extensions: 230271 Number of successful extensions: 732 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 732 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -