BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o14 (577 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein ... 25 1.3 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 1.8 AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family prote... 25 2.3 EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. 23 5.4 >CR954257-5|CAJ14156.1| 227|Anopheles gambiae predicted protein protein. Length = 227 Score = 25.4 bits (53), Expect = 1.3 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 71 LLLLQADLHPSLGQWENYLYPLHLLAPSDDLFGSNN 178 LLLL LHPS+G E + +P ++ S +L + N Sbjct: 21 LLLLTVLLHPSVGAQELFAFPADVVV-SPNLENARN 55 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.0 bits (52), Expect = 1.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 284 NLSKMRPEEIESISKRLENGEISEDNSTDNEDDINYYS 171 N+ + ++ IS +E +DN TDN D+ YYS Sbjct: 395 NIVSLVRDQYNKISSSVE----MKDNRTDNVIDVKYYS 428 >AB107248-1|BAE72063.1| 278|Anopheles gambiae Bcl-2 family protein Anob-1 protein. Length = 278 Score = 24.6 bits (51), Expect = 2.3 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 113 WENYLYPLHLLAPSDDLFGSNNSLCHLHCR 202 W N P+H L S D+ LC + R Sbjct: 48 WTNKRSPIHHLTTSQDVINQGKCLCGEYIR 77 >EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. Length = 481 Score = 23.4 bits (48), Expect = 5.4 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 236 TALICSQSLLVAFLINFYNKIKIKVIPT 319 TAL S LL+A +INF K K + T Sbjct: 244 TALDASTRLLMASVINFKGKWKFQFTKT 271 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 468,155 Number of Sequences: 2352 Number of extensions: 7905 Number of successful extensions: 51 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -