BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o14 (577 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07490.1 68414.m00802 expressed protein 28 3.9 At2g30690.1 68415.m03742 expressed protein contains Pfam profile... 28 5.1 At1g61090.1 68414.m06878 hypothetical protein 27 9.0 >At1g07490.1 68414.m00802 expressed protein Length = 107 Score = 28.3 bits (60), Expect = 3.9 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 318 RQAIQKNNGTEVQKVF-IAKELVGRFYVGRNA*SIKIHTHKNST 446 R + +K G+ QK +AKE GRFY+ R ++ + HK+ + Sbjct: 64 RSSSKKEKGSITQKYSSLAKEQKGRFYIMRRCVAMLVCWHKHDS 107 >At2g30690.1 68415.m03742 expressed protein contains Pfam profile PF04576: Protein of unknown function, DUF593; expression supported by MPSS Length = 788 Score = 27.9 bits (59), Expect = 5.1 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -3 Query: 254 ESISKRLENGEISEDNSTDNEDDINYYS 171 E ++ + E+G +E+ S+++ED N YS Sbjct: 509 EPLTSKSESGSFAEEQSSEDEDGSNIYS 536 >At1g61090.1 68414.m06878 hypothetical protein Length = 238 Score = 27.1 bits (57), Expect = 9.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 272 MRPEEIESISKRLENGEISEDNSTDNE 192 MRPE + I K+L + ++ N TDNE Sbjct: 1 MRPETLAVIQKQLTKIKAAQRNMTDNE 27 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,500,349 Number of Sequences: 28952 Number of extensions: 162652 Number of successful extensions: 424 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1121903184 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -