BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o13 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 6.7 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 6.7 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.8 bits (44), Expect = 6.7 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +2 Query: 488 QQKTENLKTCFLNLKQSFPTVESANNLSLVE 580 +Q+T++L F L++ PT+ S + LS ++ Sbjct: 263 RQRTQSLNEAFAALRKIIPTLPS-DKLSKIQ 292 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -3 Query: 97 SQHTGSENRYQDSLPHHCNKET 32 SQ N+ + HHCN++T Sbjct: 51 SQPHQDHNKEKSKNNHHCNQDT 72 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,508 Number of Sequences: 438 Number of extensions: 3780 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -