BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o07 (318 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L35848-1|AAA62319.1| 214|Homo sapiens IgE receptor beta subunit... 30 1.7 D26350-1|BAA05384.1| 2701|Homo sapiens type 2 inositol 1,4,5-tri... 28 6.9 >L35848-1|AAA62319.1| 214|Homo sapiens IgE receptor beta subunit protein. Length = 214 Score = 29.9 bits (64), Expect = 1.7 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = +3 Query: 3 PVSTRIQKNLNTKLIHNFNNLIQFKTSNLKMITDIQLAVFSNILGVSIFLLVILYHY 173 P S + LNT + H N ++ + L+++ IQ+ + IL + +FL + Y Y Sbjct: 20 PGSETGPEELNTSVYHPINGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPY 76 >D26350-1|BAA05384.1| 2701|Homo sapiens type 2 inositol 1,4,5-trisphosphate receptor protein. Length = 2701 Score = 27.9 bits (59), Expect = 6.9 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -1 Query: 255 KHIFLLETPMLLQWPRLTYIIWNYSHLCSD 166 KH+ L TP LL+ + +I N HLC++ Sbjct: 1258 KHLNLFLTPGLLEAETMRHIFMNNYHLCNE 1287 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 37,286,351 Number of Sequences: 237096 Number of extensions: 599512 Number of successful extensions: 4505 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4505 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4505 length of database: 76,859,062 effective HSP length: 79 effective length of database: 58,128,478 effective search space used: 1511340428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -