BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10o07 (318 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT001461-1|AAN71216.1| 56|Drosophila melanogaster GM20929p pro... 62 1e-10 AE013599-856|AAZ52820.1| 40|Drosophila melanogaster CG33774-PA... 60 5e-10 AY118993-1|AAM50853.1| 226|Drosophila melanogaster LP02768p pro... 26 9.1 AE013599-581|AAF59142.1| 226|Drosophila melanogaster CG8717-PA ... 26 9.1 >BT001461-1|AAN71216.1| 56|Drosophila melanogaster GM20929p protein. Length = 56 Score = 62.5 bits (145), Expect = 1e-10 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +3 Query: 90 KMITDIQLAVFSNILGVSIFLLVILYHYINANSSK 194 KMITD+QLA+FSN+LGV +FLLV+ YHYINAN+ K Sbjct: 16 KMITDVQLAIFSNVLGVFLFLLVVAYHYINANTGK 50 >AE013599-856|AAZ52820.1| 40|Drosophila melanogaster CG33774-PA protein. Length = 40 Score = 60.5 bits (140), Expect = 5e-10 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 93 MITDIQLAVFSNILGVSIFLLVILYHYINANSSK 194 MITD+QLA+FSN+LGV +FLLV+ YHYINAN+ K Sbjct: 1 MITDVQLAIFSNVLGVFLFLLVVAYHYINANTGK 34 >AY118993-1|AAM50853.1| 226|Drosophila melanogaster LP02768p protein. Length = 226 Score = 26.2 bits (55), Expect = 9.1 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +3 Query: 93 MITDIQLAVFSNILGVSIFLLVILYHYI-NANSSK*YRSIAAIVKALVSLI 242 ++T+ Q V NI+G ++FL+ L +Y+ N + ++ LV +I Sbjct: 61 VLTNEQSIVLVNIIGSTLFLVYTLIYYVFTVNKRACVKQFGFVLTVLVVVI 111 >AE013599-581|AAF59142.1| 226|Drosophila melanogaster CG8717-PA protein. Length = 226 Score = 26.2 bits (55), Expect = 9.1 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +3 Query: 93 MITDIQLAVFSNILGVSIFLLVILYHYI-NANSSK*YRSIAAIVKALVSLI 242 ++T+ Q V NI+G ++FL+ L +Y+ N + ++ LV +I Sbjct: 61 VLTNEQSIVLVNIIGSTLFLVYTLIYYVFTVNKRACVKQFGFVLTVLVVVI 111 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,547,775 Number of Sequences: 53049 Number of extensions: 193605 Number of successful extensions: 298 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 298 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 298 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 652945002 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -